SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6VKB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VKB3
Domain Number 1 Region: 33-90
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000105
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6VKB3
Sequence length 310
Comment (tr|F6VKB3|F6VKB3_CALJA) Stimulated by retinoic acid 8 {ECO:0000313|Ensembl:ENSCJAP00000051264} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=STRA8 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
LIMATPEESSNPHESMTPQLPAQPQDLDSRVARRRLSQARHRATLAALFDNLRKTVYSQS
DLTASKWQVLNKAKSYIPELEQTLDNLLKLKVSLNLEDGHASSLEEVKKEYASMYSGNDS
FPQNGSSPWYLNFYKQTMDLLTGSGIVSLQEGALPIVSAAISHLWQNLSEERKASLRQAW
AQKHRDPASLAGACREAACAEGSMKDSGVDSQGASCSLVSTPEEILFEDAFDVASFLDKS
EVPSTSSSSSVLASSNPENPEEKFQLYMQIINFFKGLGCANTRVKQEASFPVDEEMIMLQ
CTETFDDEDL
Download sequence
Identical sequences F6VKB3
ENSCJAP00000051264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]