SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6VNU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VNU2
Domain Number 1 Region: 286-452,493-627
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.13e-58
Family Tandem AAA-ATPase domain 0.00048
Further Details:      
 
Domain Number 2 Region: 58-250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-35
Family SPRY domain 0.0043
Further Details:      
 
Domain Number 3 Region: 4-68
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000894
Family Tandem AAA-ATPase domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6VNU2
Sequence length 740
Comment (tr|F6VNU2|F6VNU2_MONDO) DEAD-box helicase 1 {ECO:0000313|Ensembl:ENSMODP00000012882} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=DDX1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
FFLFAEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKDQQEGKKGKTTVKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWH
GCRSTKGVMKGKYYYEVSCHDQGLCRVGWSASQASLDLGTDKFGFGFGGTGKKSHNKQFD
GYGEEFTMHDTIGCYLDIDKGQVKFSKNGKDLGLAFEIPAHLKNQALFAACVLKNAELKF
NFGEDEFKFPPKDGFVGLCKASDGHIVKSQHTGSAQVAQTKFLPNAPKALIVEPSRELAE
QTLNNVKQFKKYVDNPKLRELLIIGGVAARDQLSILEQGVDIVVGTPGRLDDLVSTGKLN
LSQIRFLVLDEADGLLSQGYSDFINRIHNQIPQITSDGKRLQVIVCSATLHSFDVKKLSE
KIMHFPTWVDLKGEDSVPETVHHVVVPVNPKTDRLWERLGKTHIRTDEVHAKDNTRPGAN
SPEMWSEAIKILKGEYTVRAIKEHKMDQAIIFCRTKIDCDNLEQYFMQQGGGPDKKGHQF
SCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAVSLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLS
DIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGTYKGHVDILAPTVQELAALEK
EAQTSFLHLGYLPNQLFRTF
Download sequence
Identical sequences F6VNU2
13616.ENSMODP00000012882 ENSMODP00000012882 ENSMODP00000012882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]