SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6VPV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VPV3
Domain Number 1 Region: 124-258
Classification Level Classification E-value
Superfamily Acid proteases 2.88e-39
Family Retroviral protease (retropepsin) 0.00006
Further Details:      
 
Domain Number 2 Region: 2-133
Classification Level Classification E-value
Superfamily dUTPase-like 3.79e-25
Family dUTPase-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6VPV3
Sequence length 274
Comment (tr|F6VPV3|F6VPV3_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000036812} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
LARATTGSAGLDLCSSSNRILTPEDGPEVISTGVTGPPPPGMFFLIIGRALTTLQGVVVH
PTLVDNDYTGEIKLIVESPHGPVTIPAGHRLAQALPLPMVGDFPTIEQTRGPSSPGSSNI
YWAQQITESRPTLQLSLDGKKFIGLLDTGADSTVISHKHWPCAWPLQPSTTHLSGIGQVN
HTLQSSKFLTWRDAEGNTGTTRPYIVKGLPVNLWGRDILAQMRLLMVSPSDPVTQMMLKS
GFLPGKGLGKNEQGDPQPISLTPNRDKAGFGSQN
Download sequence
Identical sequences F6VPV3
13616.ENSMODP00000036812 ENSMODP00000036812 ENSMODP00000036812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]