SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6VXF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VXF6
Domain Number 1 Region: 128-289,359-380,587-699
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.32e-41
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 
Domain Number 2 Region: 42-146
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000196
Family YVTN repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6VXF6
Sequence length 925
Comment (tr|F6VXF6|F6VXF6_CALJA) Coronin {ECO:0000256|RuleBase:RU280818} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MNRFKVSKFRHMEARLPRREAWISDIRAGTAPSFRNHIKSSRSLIAFNSDCPGVLGIVPL
QGQGEDKRCVAHLGCHSDLVTDLDFSPFDDFLLATGSADRTVKLWRLPAPSQPLPSAPGV
VLGPEELPVEVLQFHPTSDGILVSASGTTAKVWDVAKQQPLTELAAHGDLVQSAIWSRDG
TLVGTACKDKQLRIFDPRAKPQTSQSTEAHKNGRDSRLAWTGTQEHLVSTGFNQMREQEV
KLWDTRFSSALASLTLDTSPGYLLPLLDPDSGLLVLAGKGERQLYCYEVVPQQPALSPVT
QCVLESVLRGAALVPRQVLAVMSCEVLRVLQLSDTAIVPISYHVPRKAVEFHEDLFPDTA
SCVPASDPHSWWAGDNQQVQKVSLNPACRPYPSFTSRLVPPMEPLPNTAQPAVMKTPVGD
ADPSEDFSSPPSSLTSPSTPSSLGPSLSSTSGIGTSPSLRSLQSLLGPCSKFRHAQGTVL
HRDSHITNLKGLNLTTPGECDGFCANKLRVAVPLLSSGGQVAVLEVRKPGRLPDTALPTL
QNGAAVTDLTWDPFDPRRLAVGKEAGCPGLREGPGKGLERGAQPHPKTVLTGHMEKICSL
RFHPLAADVLASSSYDLTVRIWDLQAGVERLKLQGHRDQIFSLAWSPDGQQLATVCRDGR
VRVYRPLSSPEPLQEGPGPKGGRGARIVWVCGGRCLLVSGFDSRSERQMLLYEAETLAGG
PLAVLGLDVAPSTLLPSYDSDTGLVLLTGKGDTRVFLYELLPESPFFLECNSFTSADPHK
GFALLPKTECDVREVEFMRCLRLRQSSLEPVAFRLPRVRKEFFQDDVFPDTAVCWEPVLS
AEAWLQGATGQPRLLSLQPPDMSPVSQAPRETPARRAPSSAQYLEEKSDQQKKEELLNAM
VAKLGNRDDPLPQDSFEGVDEDEWV
Download sequence
Identical sequences F6VXF6
ENSCJAP00000048215 ENSCJAP00000049709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]