SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6W031 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6W031
Domain Number 1 Region: 44-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000223
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  F6W031
Domain Number - Region: 95-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0512
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6W031
Sequence length 261
Comment (tr|F6W031|F6W031_MACMU) Fibulin 7 {ECO:0000313|Ensembl:ENSMMUP00000002986} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=FBLN7 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
AGSARTLGTAAGGHGVGKGLSPTVLLPARVASWARSQKAWPLCIIDVNECELYGQEGRPR
LCMHTCVNTPGSYRCTCPSGYLTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVS
PECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMA
TASAPGRAGPNSLRFGIVGGSSRGHFVMQRSDRQTGELILVQTLAGPQTLEVDVDMSEYL
DRSFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences F6W031
ENSMMUP00000002986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]