SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6W5S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6W5S4
Domain Number 1 Region: 449-705
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-61
Family YWTD domain 0.000000835
Further Details:      
 
Domain Number 2 Region: 1363-1620
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-56
Family YWTD domain 0.0000033
Further Details:      
 
Domain Number 3 Region: 751-1006
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-55
Family YWTD domain 0.00000141
Further Details:      
 
Domain Number 4 Region: 1058-1314
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-48
Family YWTD domain 0.00000329
Further Details:      
 
Domain Number 5 Region: 272-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 6 Region: 236-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 317-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 151-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 9 Region: 74-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 10 Region: 1318-1362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000317
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 11 Region: 195-233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 112-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 13 Region: 366-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 708-744,1002-1052
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000832
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 15 Region: 395-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 16 Region: 34-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  F6W5S4
Domain Number - Region: 1620-1657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000998
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6W5S4
Sequence length 1904
Comment (tr|F6W5S4|F6W5S4_MONDO) LDL receptor related protein 4 {ECO:0000313|Ensembl:ENSMODP00000024825} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LRP4 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MRRPGGSLLLLLLLLLRLGALLGAHGLASSPECACGRSHFTCAVSALGECTCIPAQWQCD
GDNDCGDHSDEDGCMLPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEE
DEFPCQNGYCIRSLWHCDGDNDCGDNSDEQCDMRKCSEKEFRCSDGSCIAEHWYCDGDTD
CKDGSDEESCPSAVPAPPCSLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCR
SGEFMCDSGLCINAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCKSGRCVRLSWRCDGE
DDCSDNSDEENCENTGSPQCASDQFLCGNGRCIGQRKLCNGVNDCGDSSDESPQQNCRPR
TGQENCNVNNGGCAQKCQMVRGAVQCTCHTGYRLMEDGRSCQDVNECEEEGYCSQGCTNS
DGAFQCWCEAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIA
LDFHHRRELVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWLHDKLYWTDSGT
SRIEVANLDGAHRKVLLWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRII
ADTHLFWPNGLTIDYAGHRMYWVDAKHHVIERADLDGSNRKAVISQGLPHPFAITVFEDS
LYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGRNRCGNNNGGCTHL
CLPSGQNYTCACPTGFRKTSSHSCAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADV
RSAVALDWDSRDDYVYWTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYW
TDAGTDRIEVANTDGTMRTVLIWENLDRPRDIVVEPRGGFMYWTDWGASPKIERAGMDAS
GRQVIISSNLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGTQLPHPFGLT
LYGERIYWTDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRLRPPVHTPCAVENGG
CSHLCLRSPHPKGYSCTCPTGINLLADGKTCSSGMRSFLIFARRIDIRMVSLDIPYFADV
VVPVNITMKNTIAIGVDPQEGKVYWSDSTLRKISRANLDGSHHEDIITTGLQTTDGLAVD
AIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGSMYWTDWGENAKL
ERAGMDGSDRAVLINNNLGWPNGLTVDKAGSQLLWADAHTERIEAADLNGANRRTLVSPV
QHPYGLTLLDSYIYWTDWQTRSIHRADKGTGSNVILVRANLPGLMDIQAVDRQRPLGSNK
CGPKNGGCSHLCLPRPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTS
DHTDVHVPVPELNNVISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDG
LAVDWVARNLYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAAFPRKGYLFWTDWGH
LAKIERSNLDGSERKLLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVL
VSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQT
GTNACGVNNGGCTHLCFARALDFVCACPDEPDDRPCSLVPGLVPPAPKSTSTSEKSPGPL
NTPSTTSRSSTARTHTSLEESEGNCSEKDGRQGLCAHSNEAVPAAPGEGLHVSYMIGGLL
SILLILVLIAALVLYRHKKFKFTDPGLGNLTYSNPSYRTSTQEVKIETIPKPAMYNQLCY
KKEAGPEHNYTKEKIKIVEGICLLSGGGAMDQTQPVPQGPPSLSLCWSSTRASSRPPPKL
ACTEHIVCDFDPGGGPAQVLLHDGEADFLHDFGQIFFGGGPGLL
Download sequence
Identical sequences F6W5S4
ENSMODP00000024825 ENSMODP00000024825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]