SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6WH61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WH61
Domain Number 1 Region: 62-503
Classification Level Classification E-value
Superfamily Cytochrome P450 3.8e-92
Family Cytochrome P450 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6WH61
Sequence length 509
Comment (tr|F6WH61|F6WH61_MONDO) Cytochrome P450 family 27 subfamily A member 1 {ECO:0000313|Ensembl:ENSMODP00000019193} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CYP27A1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MQNLGSLVMRGRLAQLLVPLRMVPPRCPLGARAKAVDPTALPPELAEAPGAVSSTAGPEA
RQLRSLDELPGPGQLHSLFRLFVQGYVLHLHELQVVLKSKYGPIWKLPLLPYTSVYLANA
SLMEQLLRQEGKHPLRHDMALWKEHRDSRGFAYGPFTTEGEEWYQLRQALNSRMLKPSDA
ALYTDSLNEVIGDLLVQLEDIKAKSLSGDQVPDVANFFYFFALEAITYILFEKRIGCLKP
PIHPEMETFVKSVGLMFKNSLYVTFLPKWTRPLFPFWNRYLENWDIIFTFGKKLIEEKLK
DMAAELKDGNSDKIRMSGYLHFLLSSGELTPDEAVGSLAEILLAGVDTTSNTMTWALYHL
AQDPETQEALYKEVVGVVPPGKIPQYKDFAHMPLLKAVLKETLRLYPAVPTNSRVNSEKD
VIVGDFLFPKNTQFVLCHYAMSHDPDIFPSPKKFLPKRWLRRNQTGPVGVNHAFGSIPFG
YGVRACLGRRIAELEMYLVLSRVRDGGNW
Download sequence
Identical sequences F6WH61
ENSMODP00000019193 ENSMODP00000019193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]