SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WN60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WN60
Domain Number 1 Region: 174-278
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-32
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 2 Region: 73-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 113-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000587
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6WN60
Sequence length 280
Comment (tr|F6WN60|F6WN60_CALJA) Hyaluronan binding protein 2 {ECO:0000313|Ensembl:ENSCJAP00000049079} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HABP2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MFARMSDLHVLLLMALVGKTAFGFSLMSLFDALDPDWTPDLYDESYEYSDQEETTSSTLA
QPENPDWYYTEDQVDPCEPNPCEHGGDCLVHGSTFTCSCLDPFSGTKCQKVQNRCKDNPC
GRGQCLITQSPPYYRCACKHPYTGPNCSQVVPVCRPNPCQNGGTCSRHKRRSKFTCACPD
QFKGRFCEIGSDDCYVGDGYSYRGKINRTVNQHTCLYWNSHLLLQENYNMFMEDAEAHGI
GEHNFCRNPDADEKPWCFIKVSSDKVKWEYCNVTACSAQA
Download sequence
Identical sequences F6WN60
ENSCJAP00000049079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]