SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6WPD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WPD8
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.59e-40
Family L-arabinose binding protein-like 0.0028
Further Details:      
 
Weak hits

Sequence:  F6WPD8
Domain Number - Region: 197-244
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00306
Family TNF receptor-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6WPD8
Sequence length 544
Comment (tr|F6WPD8|F6WPD8_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000017342} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
TFNGALTFSYLTSEIPGFKTFLKTITPSKYPDDILLRGFWLSAFMCPKQPEKSEQEICSA
NASLETLPLCYFDMAMSGLSYTIYNTVYAVAWALHEIFMRKSEKRLMEDEEYLVLPSWQL
HSFLKNIQFNNSAGDEVFVDESRSSEAQYAIFNYMFLPNETDILVKVGQFVPKAPLGQDF
TICENSIEWGWWGSKVPHGVCSESCHPGFRKTLLEGKAICCFDCSPCPDGEISSHMDAED
CMKCPEIEYPNQQKDHCLSKIVTFLNMKESLGMMLTLVSISFSFLTALVLGVFVKFQDSP
IVKANNRTLSYTLLISLIFCFLCSLLFIGQPTTATCCLQQTVFAVVFTVAVSSILSKTII
VLLAFRSISPGSRIRMFMHPRVSVYVVLIGSGLQVILCGIWLGTSPPFPEADTQSEYGHI
IIRCNEGSAFAFYCVLGYMGFLALGSFTVAFLARNLPDAFNEAKFITFSMLVFCSVWATF
LPTYQSSKGKAMVTVEIFSILASSAGLLGCIFIPKCYMILLKSDRNTQGQIKNKRDSRGK
TFAG
Download sequence
Identical sequences F6WPD8
ENSMODP00000017342 13616.ENSMODP00000017342 ENSMODP00000017342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]