SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6X418 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6X418
Domain Number - Region: 25-119
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.034
Family Myosin rod fragments 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6X418
Sequence length 123
Comment (tr|F6X418|F6X418_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000036608} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
SSSSEEEDERDSHDDEDINIIDTEEDLERQLQDKLDESSEQCQEDEQTNQMVMGIQKQID
IMKGKLQETQGRVKRQEDLIIKVENIALKIRLQAMLDEFKQQKEQEKQQLSSLVEQLESL
LEK
Download sequence
Identical sequences F6X418
ENSMODP00000036608 ENSMODP00000036608 13616.ENSMODP00000036608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]