SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6X5V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6X5V9
Domain Number 1 Region: 33-127
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-22
Family I set domains 0.0052
Further Details:      
 
Domain Number 2 Region: 162-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000738
Family EGF-type module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6X5V9
Sequence length 637
Comment (tr|F6X5V9|F6X5V9_MONDO) Neuregulin 2 {ECO:0000313|Ensembl:ENSMODP00000031602} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=NRG2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSETKRKGRGRGKKHREGRKRERERAPELGDEAVPPKLKKMKSQTAQVGEKQSLKCEAAA
GYPQPTYRWYKDGKELNRSKDIRIKYGNGKNSRLQFNKVKLEDAGEYVCEAENILGKDTA
KGRLNVNSGMSLGESGSYSNNMSFYMSLLFPVATTLSSWSGHARKCNETAKSYCVNGGVC
YYIEGINQLSCKCPVGYTGARCQQFAMVNFSKHLGFELKEAEELYQKRVLTITGICVALL
VVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEELQMADYISKN
VPATDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHSHTWSLEQTESLTSDSQSGIMMS
SVGTSKCNSPACIEARARREAACNIEDERRPAMPYHDSVDSLRDSPHSERYVSALTTPAR
LSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISFRLAEQQPLLRHSPATAAAASAA
PASDMQRSYDSYYPPRRGCSHDSMGSLPASPFRITEDDEYETTQECAPTLEPPKRTATGH
RRWRKSRLNGHMAQRARAVRDSFSLSSASYSESDEELVAECTPFLSIHTSDMLGTDSPPL
YQPVDSRTYYSLDRHSTQESRHSRITHPRGKQDSAPL
Download sequence
Identical sequences F6X5V9
ENSMODP00000031602 ENSMODP00000031602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]