SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6X937 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6X937
Domain Number 1 Region: 7-127
Classification Level Classification E-value
Superfamily POZ domain 6.02e-27
Family BTB/POZ domain 0.0004
Further Details:      
 
Domain Number 2 Region: 520-580
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 6.8e-21
Family A DNA-binding domain in eukaryotic transcription factors 0.0013
Further Details:      
 
Domain Number 3 Region: 566-609
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000141
Family Leucine zipper domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6X937
Sequence length 736
Comment (tr|F6X937|F6X937_CALJA) Transcription regulator protein BACH1 {ECO:0000313|EMBL:JAB08213.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=BACH1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFH
SRIVGQADAELSITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEE
SCFQFLKFKFLDSTTDQKEGPRNKCFPSHCQKTELKFSLLDQRDLETDEAEEFLENKNVQ
TPQCKLRRYQGNAKVSPPLQDSASQTYESMCLEKDAPLALPSLCPKYRKFQKAFGTDRVR
TGESGVKDIHASVQPNETSDNECLGGVPECGDLQVMLKCDESKLAVEPEETKKEPASQCP
TEKSEVTPFPHNSSIDPHGLYSLSVLHTYDQYGDLSIAGMQNTAVLTEKPLSGTDVQEKT
FGESQDLPLKSDSGPREDSSLASSDRSSVEREVAEHLAKGFWSDICSTDSPCQMQLSPAV
AKDGSEQISQKRSECPWLGIRISDSPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGN
DDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRND
FQSLLKMHKLTPEQLDCIHDIRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQNEKESLL
KERDHILSTLGETKQNLTGLCQKVCKEAALSQEQIQILAKYSASDCPLSFLISEKDKSTP
DGELALPSIFSLSDGPPAVLPPGARGNSESGYARGQESQHTSTAASEQARPAEQCHQSAG
ISDFCKQMTDKCTTDE
Download sequence
Identical sequences F6X937
XP_002761387.1.60252 XP_002761388.1.60252 XP_008984794.1.60252 XP_008984795.1.60252 XP_008984797.1.60252 XP_017822667.1.60252 XP_017822668.1.60252 ENSCJAP00000015943 ENSCJAP00000043528 ENSCJAP00000051511 ENSCJAP00000015943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]