SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6XG21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XG21
Domain Number 1 Region: 162-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-27
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.62e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 108-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.69e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6XG21
Sequence length 390
Comment (tr|F6XG21|F6XG21_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000007165} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
EVVTFQDVAVDFTREEWRLLSPPQKELYKEVMLENVRNLLSVECSTSRLPIDAILGESFE
TFRRVPDTSTTFIDLMELQSVSCTFQYRLGSSSVQKTNHKRKFCVAPQNSSHIEHQRMHT
EEKSSERNQCRKTLMHRASLAGHQKIHTGEKPYECKECGKKFRQSSDLAVHQRIHTGDKP
YECKQCGKSFSQSSHLARHQRIHTGEKPYECKQCGKAFSQSSCLVLHQRIHTGEKPYECK
ECGKTFSMSSHLAVHQRIHTGEKPYECKECGKTFRLSSSLAVHQRIHTGEKPYECKQCGK
TFSRSYYLAVHQRMHTGEKPYECKQCGKMFSRSSHLVVHQRTHTGERPFECNQCGKTFKE
RSKLAVHRRTHTGEKPYECKQCGKTFGRSC
Download sequence
Identical sequences F6XG21
13616.ENSMODP00000007165 ENSMODP00000007165 ENSMODP00000007165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]