SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6Y1V8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Y1V8
Domain Number 1 Region: 509-750
Classification Level Classification E-value
Superfamily vWA-like 1.61e-75
Family Trunk domain of Sec23/24 0.00000471
Further Details:      
 
Domain Number 2 Region: 751-843
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 5.49e-39
Family beta-sandwich domain of Sec23/24 0.00075
Further Details:      
 
Domain Number 3 Region: 953-1101
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.57e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.00097
Further Details:      
 
Domain Number 4 Region: 283-475
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 7.59e-28
Family beta-sandwich domain of Sec23/24 0.0019
Further Details:      
 
Domain Number 5 Region: 879-950
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 0.00000000000146
Family Helical domain of Sec23/24 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6Y1V8
Sequence length 1102
Comment (tr|F6Y1V8|F6Y1V8_MONDO) SEC24 homolog A, COPII coat complex component {ECO:0000313|Ensembl:ENSMODP00000017800} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SEC24A OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAQPGRLGASSPAQNGAISAAGPPYSNGPLQSPLMHSQVSGSQGYNSPFPGSYSHQIPAK
TPLNPASGLYNYGGSQTVSSLNSYQGPGQTLNRLPLEPNPVAPLQSTVPTSQMPPLPSSQ
TPAVIPASSNSFVYGSDPSSSSNWQYGHPPMGSKTNHFVPVSTQPSLSGNTNMSRNNQYV
SPGAPSLQNSYMKTGSSVPPPTNQTLPTIYQPTRAPLGPPPSGGPPPARSLDPQRKTSNS
VPPQPQLTSSSLNQEGDSSTANNGSVVENSYDTIEGGGFMAATQFANQNPKMNRNVGYSY
PSLPPGYQNTSDPNMSGRPSTALQYTSGLQPFSQSPLGANHLTTSMSGLSLHPEGLRVIN
LLQERNMLPTTPLKAPVPNLHEDIQKLNCNPELFRCTLTNIPQTQALLNKAKLPLGLLLH
PFKDLLQLPVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFMYNPMTR
VYGNPLRRPEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDN
LDSLPGNTRTKIGFITFDSTIHFYSLQEGLSQPQMLIVSDIEDVFIPMPENLLVNLNENK
ELIQDLLKTLPQMFTKSLETQSALGPALQSAFKLMSPTGGRISVFQTQLPSIGVGALKSR
EEPNQRSSAKEIHLTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGS
VYYYPSYHHQHNPVQVEKLQKELKRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTD
LLSLPNVNPDAGYAVQMSVEENLTDIQVVSFQSALLYTSSKGERRIRVHTMCLPVVSTLN
EVYLGADVQAISGLLANMGKITNYTDFLMNSAHPPNSIKCYNMLGGXRTSVLSSQQPGLL
FPFSLRLFPLFVLALLKQKSFQTGTAARLDERIFAMCQVKNQPLVYLILMTHPNLYRVDN
LSDEGALNINDKTIPQPPILQLSVEKLSRDGAFLMDAGTVMMLWVGKNCGQNFLSQVLGV
PNYASLPLNMTHLPDLDTAESTRLGGFISWLREHRPFFPILYIIRDESPMKSIFLQYMVE
DRTESALSYYEFLLHVQQQVNK
Download sequence
Identical sequences F6Y1V8
ENSMODP00000017800 13616.ENSMODP00000017800 ENSMODP00000017800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]