SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6Y5F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Y5F1
Domain Number 1 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000119
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 804-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000105
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 1003-1053
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000195
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  F6Y5F1
Domain Number - Region: 420-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0068
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6Y5F1
Sequence length 1072
Comment (tr|F6Y5F1|F6Y5F1_MONDO) Zinc finger protein 827 {ECO:0000313|Ensembl:ENSMODP00000000623} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ZNF827 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MPRRKQEQPKRLPSHGSRQEDAEGELSEEEHWFGNSSETPSEASYGEVQENYKLSLEDRI
QEQSTSPDTSLGSATPSSNTLELIALENEALRDPLQCQDHLSPGVSSLCDDDPPGSNKPL
SSNLRRLLEAGSLKLDATVTANGRVESPVNLGSNLSFSPPSHHAQQLSVLARKLAEKQEQ
NDQYIAGNRFIWNQGKWLPNSTTTCGLSPDSAILKLKAAANAVLQDKSLTRTEETMRFES
FPSPFSSQSASSTLAALSKKVSERSLTPGQEHSPPASSFLSLASMTSSAALLKEVAARAA
GSLLAEKSSLVPEDPSPPQPLEKKQEKGTPPQSLELLLLPVPKGRVSKPTNPAPEEEGGK
PFQCPICGLVIKRKSYWKRHMVIHTGLKSHQCPLCPFRCARKDNLKSHMKVHQHQDRGET
FQCQLCPFTSSRHFSLKLHMRCHQHFLRTEAKVKEEIPEMDVKGSPQLSESACLGQQREG
VGTELVGTPVMSRTPERTSQSSAGIPPLLVKEEPKEDNGLSPSFTLNVAERPVNNTKLKD
TSDYVANTASALFSQDISVKMASDFLMKLSAANQKEPMTLTFKVKEEPKDEEAINSTLSQ
SSYIFRPGSEGSAPSLPEDTMKPQEGQMNTLRRDMSVKAASELLMKLSAESYKETQTVKI
KEEPMEVDIHDSPVSISPSRNVGYSTLLGREKTEPLQKMPEGRMGPERSLFSQDISVKMA
SELLFQLSEKVSKEHNHTKENTIRTTTSPFFSEDSFRQSPFTSNSKDLLPSESVLHSGTS
VPETEKIGLEAGNGLPSWKFNDQLFPCDVCGKVFGRQQTLSRHLSLHTEERKFKCHLCPY
AAKCRANLNQHLTVHAVKLVSTDTEDIVSAVTSEGSDGKKHPYYYSCHVCGFETELNVQF
VSHMSLHVDKEQWMFSICCTSCDFVTMEEADIKAHISTKHTGEERKTPSESTSPSSSSLS
ALSDSANSKDDTDVTQKTKGGNNLLVISVVPGSQPLLNTEEKSEKGFECVFCNFVCKTKN
MFERHLQIHLITRMFECDVCHKFMKTPEQLLEHKKCHTVPTGGLNLCSRMTK
Download sequence
Identical sequences F6Y5F1
ENSMODP00000000623 ENSMODP00000000623 XP_007496324.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]