SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6YRY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YRY9
Domain Number 1 Region: 409-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000416
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 2066-2114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000826
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 
Weak hits

Sequence:  F6YRY9
Domain Number - Region: 955-983
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000381
Family C2HC finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6YRY9
Sequence length 2251
Comment (tr|F6YRY9|F6YRY9_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000013217} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MPRTKQIHPRNLRDKIEEAQKELNEAEDSHKEILETGVKGTTDTVIGVKRKKIVNENHLK
KIPKSPLRNPLQTKLKENTGESSFNVLHRTSEYQKEENQIPIENGKQFTKQNGETLTVTT
KASKAETSVPPKKLSLSQHSLELRKWRSEGSDLGEFNLPGEQCVSSSMSSMTKTDNSECM
TFNCKTTSSSYTSTAFDVLLKAMEPELSTLSQKGPSCAIKVEKLRPNKVARSPSKLKNSQ
SASDHSLSHQEFVPDSQVSPCTSQTVHVSAAGKDEQTPIQTVSPSHTLHEQFISKSSQHN
QQLSVCPEGFTRSFTHQQSQDNPHIPHVYNIAVTPSASHTPPSNVSQVIPQNQPVDSSSP
MSVNPANSTQLPIAPMYNSAQVASIVNHSVEQMYNLILKDQKPKKQGKYICEYCSRACAK
PSVLLKHIRSHTGERPYPCVTCGFSFKTKSNLYKHKKSHAHAIKLGLVLQPDSSGLFLSH
ESNKALNIHSDVEESGESDDEGTADERQDDQGSIELESTQIMKIISNSETLQKSSSLPSN
PDHVLGDFSLQENSSDSQGRTALPKVVVHPVNISPLRAESPKITDSTSELPNTPKQRDIQ
VTNTKSNSDIVSSSETDDKLHQKGDITQLEERQAFHVGTIHAHYKGSRLLMSPEHKESIC
ESSKLGSTDSGYFSRSESTDQTMSPPPPFARVLPSTEKDPNKNNGPYTAPVTTAPPSAAQ
TASGEKAFVLSAQMRPPMATKTLEERISKLISDNEALVDDKQLDSVKPRRTSLSRRGSID
SPKSYIFKDSFQFDLKPIGRRTSSSSDIPKSPFTPTEKSKQVFLLSVPSLDCLPITRSNS
MPTTGYSAVPANVIPPPHPLRGSQSFDDKIGSFYDDVFVSGPHSSVQQSGHPRTLVRQTA
IEDSSSSENHVLGTTQSSDEGYLGCNVSNETLLPRSKSFAQGSNLEKKKSHQGRGTMFEC
ETCRNRYRKLENFENHKKFYCSELHGPKTKVAIREAEHSPGPNSTQPPVLHYRMAGSSGV
WEQAPQIRKRRKMKSVGDDDELQQNESGIVSKSLEGIQCQNISGSTSLSKHNVNTSGKQS
GCITLQKSQIQLVTRGIEQTTEPKLSPIIEKQINSGMLEKIELKRQGTGNSVIQHTNSLS
RPISFEKFEPFERSPPISFQEGNRSMKHGPLKTIKIIQEDGCIPGSTVHHPQLVLSDSPR
VEFQGSPRVVSNERNLLIQSRLVRQHNIQVPEILVTEEPDRDLEIQSNGQEKTEKFNWPQ
RSETLAKLPTEKLPPKKKRIRLAEMEHSSAESSFESTLSRSLSRESSLSHTSSFSASLDI
EEVSKIENTSKVESINKSELLMIPAGSQTLSVPGTPYREMRRAASEQINCTQPSMEVCDF
RSKSFDCGNTSPSKSIPLVEVQTLKSPTGFGITGHVPLLERRRGPLVRQISLNIAPDSHL
PPVIPSSFQNTLVSDITTVTFHRSQISSKSLNEFPANSLLSQIQVKDLEPAISTSISTIP
QQLLGNSLINQINFNPEHQNVQTSFGVTTQGKESDTASTKPLISESEDCFAPKYQLHFKT
LHSSQSCSNSINALSNQVLPNIVSVDQSLTSLKIPTKVVANTCSSCLLPALKHLCGQIQK
VSPFVVPVHIHSNAPPHSLATVTSLPQILVTQDQSNQPVCKANKVTVSTLESTIQMPKSH
QDHQNALPNPQKQLVHENVFSEIGQSSSLSESSTIIQKIPVSGLFPHPEVTASSKRMLSP
ANSLDIAMEKQQKRAKDENGAVCITDIRSLQLLNKKISDSNKHKKPVLVRQVCTTEPLEG
VLLDQEIIPQPGSSRDAGSLTDGILVNTSSGNKSIVEHIKNCQIENIKSSISPNLASRKS
APENIHISSLKSTNSIQERNSPVIKNKCNKMNIQELTTSSSFHSGDIQQLSFPSLKTTTS
FTWCYLVKRKPLHLPQNDQKTSAYSVWNISSSNPNPLGLPTKVALSLLNSKQKFGKSLYS
QAITTHSKSDVLVYSSKWKNNLSKRALGSQKSKVVEFSNKDTSEISNEQDKENSIMKNEP
RRVKIFDGGQSNEDYVYVRGRGRGKYICEECGIRCKKPSMLKKHIRTHTDVRPYHCNYCN
FSFKTKGNLTKHMKSKAHGKKCVDLGVSVGVIDDQDPEELGEKQRFGYEQSGYDIEDSDG
PDDDENENEDDDEDSQSESVLSAAPSVTASPQHHPTRSSLQESLSADEEIRIAECFSKVP
SDPMDALPKALPTKMTVLSSVQSDCRSSRSP
Download sequence
Identical sequences F6YRY9
13616.ENSMODP00000013217 ENSMODP00000013217 ENSMODP00000013217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]