SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6YW23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YW23
Domain Number 1 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.87e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 124-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.28e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 7 Region: 237-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.65e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 502-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.55e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 9 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.18e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 10 Region: 91-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000733
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6YW23
Sequence length 562
Comment (tr|F6YW23|F6YW23_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000030933} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
VVTFKDVAVDFTREEWRLLSPPQKELYKEVMLENAQNLLSVGLLAPPAYVLSYLEQREAP
WMVEQKGLRNCCPGERGEKRMHPEEKSSENNQCGKTFMHRVSHAGHERIHTSEGHYEYKQ
CGKTFNESSHLAKHHRIHTGEKPYECDHCGKTFSRRSILTEHKRIHTGEKPYECKQCGKT
FSQRSQLAVHQRIHTGEKPYECNLCGKTFSQRSKLGVHHRIHTGEEPYECNQCGKRFNKR
SNLARHHKIHTGEKSYECNLCGKAFSMSCYLSVHQRTHTGEKPYECKQCGKAFIMSSYLS
VHQRTHTGEKPYECKQCGKTFSRNANLAVHQKIHTGEKPYECKQCGKVFSMSCYLAVHQR
IHTGEKPYECKHCGKAFRVSSSLVTHQRIHTGEKPYECKQCGKTFSRSTNLAVHQRIHTG
EKPYECTQCGKTFSCSSSLATHQRIHTGEKPYECKQCGKAFSCSSSLATHQRIHTGVKPY
ECKQCGKTFSCSSSLAIHQRVHTGEKPYECKQCGKAFSCSSSLATHQRIHTGEKPYECKQ
CGKTFSCISSLAAHQRIHNGEK
Download sequence
Identical sequences F6YW23
13616.ENSMODP00000030933 ENSMODP00000030933 ENSMODP00000030933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]