SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6YWZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YWZ5
Domain Number 1 Region: 175-275,443-514
Classification Level Classification E-value
Superfamily TrmE connector domain 3.79e-42
Family TrmE connector domain 0.0038
Further Details:      
 
Domain Number 2 Region: 126-206,243-433
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.96e-36
Family G proteins 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6YWZ5
Sequence length 514
Comment (tr|F6YWZ5|F6YWZ5_CALJA) GTP binding protein 3, mitochondrial {ECO:0000313|Ensembl:ENSCJAP00000051979} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GTPBP3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
IVHSSIRPHPCFLLVPASEPQFPHLQTPDPGDAVWNVRWALCTRRNSGAPVPGSGATIFA
LSSGQGRCGVAVIRTSGPASGHALRILTAPRDLPPARHASLRLLSDPRSGEPLDRALVLW
FPGPKSFTGEDCVEFHVHGGPAVVSGVLRALGSVPGLRPAEAGEFTRRAFAHGKLNLTEV
EGLADLIHAETEAQRRQALRQLDGELGHLCRGWAETLTKALAHVEAYIDFGEDDNLEEGV
LEQANIEVRALEVALGAHLRDARRGQRLRSGAHVVVTGPPNAGKSSLVNLLSRKPVSIVS
PEPGTTRDVLETPVDLAGFPVLLSDTAGLREGVGPVEQEGVRRARERLEQADLILAMLDA
SDLASPSSCNFLATVVASAGAQSRSSSSQRLLLVLNKSDLLSTEGPGPGPDMPPHLLLSC
VTGEGLDGLLEALKMELAAVCGDPSTGPPLLTRARHQHHLQGCLDALGHYKQSKDLALAA
EALRVARGHLTRLTGGGGTEEILDIIFRDFCVGK
Download sequence
Identical sequences F6YWZ5
ENSCJAP00000051979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]