SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6YY71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YY71
Domain Number 1 Region: 16-496
Classification Level Classification E-value
Superfamily ALDH-like 4.32e-184
Family ALDH-like 0.0000000000000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6YY71
Sequence length 501
Comment (tr|F6YY71|F6YY71_MACMU) Retinal dehydrogenase 1 {ECO:0000313|EMBL:AFE77127.1} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_07786 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSSSGKPDLPVLPTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKADV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTNDIDKAVTISSALQAGTVWVNCYGVVTAQCPFGGFKMSGNGRELGE
YGFHEYTEVKTVTVKISQKNS
Download sequence
Identical sequences A0A2K6DYN5 F6YY71 Q4R5G3
NP_001270230.1.63531 XP_011769236.1.29376 XP_011769237.1.29376 XP_011769238.1.29376 XP_014973391.1.72884 ENSMMUP00000017493 9544.ENSMMUP00000017493 ENSMMUP00000017493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]