SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6Z127 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z127
Domain Number 1 Region: 1481-1722
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.22e-72
Family ABC transporter ATPase domain-like 0.0000189
Further Details:      
 
Domain Number 2 Region: 27-195
Classification Level Classification E-value
Superfamily CutC-like 2.22e-60
Family CutC-like 0.0000082
Further Details:      
 
Domain Number 3 Region: 818-1047
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-60
Family ABC transporter ATPase domain-like 0.000022
Further Details:      
 
Domain Number 4 Region: 1163-1471
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 1.83e-59
Family ABC transporter transmembrane region 0.0024
Further Details:      
 
Domain Number 5 Region: 498-800
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 8.89e-38
Family ABC transporter transmembrane region 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6Z127
Sequence length 1734
Comment (tr|F6Z127|F6Z127_MONDO) ATP binding cassette subfamily C member 2 {ECO:0000313|Ensembl:ENSMODP00000004154} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ABCC2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MKRRAVCRESRQGTLVPVQPEMTGGFLMEICVDSVESAINAERGGAGRIELCSGLLEGGT
TPSMGMLQVVKQCVQIPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLYGADGLVLGALT
EDGHIDTELCMALLSTCRPLPVTFHRAFDMVQNPEVALETLLTLGFDRVLTSGCDSSALE
GLPMIKQLVEQNDSFLDRPDADIPLCFEQTVLVWIPLGFLWLLAPWHLFHIYKSRTKKSS
LTTLYLTKQVLVGLLLITSIIELAFILAETAEETTHPAIQYTNPCLYIATWILVLVIHHC
RRWCVKKDSWLLFMFWILSLVCGAFQFQTLLRMLLKGNNHNLVGSCLYFISYGIQVLTVI
ISTISEITPETKASLNNPSTTASFLSTITFSWFDSIIVKGYKKPLTLEDVWDLNEQQKTQ
VISKTFAKHMAVEIKKARKELQKRCQKRKSREKPEARMNGPSTSQSQDNLVLEDVKQKKK
KNESTSETKQDFAKSWLVKALFKTFRGIFFKSFVYKLIQDILTFLSPQLLKLMISFASDP
SSYVWQGYICSVLFFVVALIQSFCLQWYFQCCFVLGMTVRTTLMASIYRKTLTISNNARK
QYTIGETVNLMSVDSQRFMDVTSFLHLLWSCPFQIILSIVFLWMELGPSVLAGVGIMILL
IPINALLATKSRKIQVKNMKNKDSRLKIMNEILSGVKILKYFAWEPSFIDYIQGIRKKEL
KNLLSFAQLQSATVFIFNMAPVLVSVITFAVYVLVDENNILDAQKAFTSITLFNILRFPL
AMLPMLISSILQVSVSTERLEKYLTGDDLDTSSIRWDVHSDRAIKFSEASFTWGTGTDPI
IKNVTLDIKTGQLVALVGAVGSGKSSLIAAMLGEMQPIHGQITIKGSIAYVPQQSWIQNG
TLRDNVLFGSQWDEKRYWQILEACALLPDLKILPGGDLAEIGEKGTNLSGGQKQRVSLAR
AVYNNSDIYILDDPLSAVDSHVGKHIFNKVIGPNGLLKDKTRLLVTHGIHFLPQVDEIAV
MANGVLMEKGSYNALLANKGTFAKNLKLYAKQDSSEREDTAGDEGESEDEDDLELMPNIE
EIPSEAVSLTLKRESSFQRSLSRRSRSDSNKHQKSLRSSLKVNDMKPKQKENKDMVKGQK
LIEKEVMETGKVKFSIYLKYLSAAGWFSIVLIFLAYTLSSVAYMGSSFWLTEWTNDSYTY
ANQTYPDSQRDLRVSIYGVLGFAQGFFVLLGTLIAAYSATHASQILHMQLLNNILRAPMS
FFDTTPTGRIVNRFANDISTVDDTIPMSFRSWTMCFLSIISTAVMICVATPVFIVVIIPL
AIIYIFVQRFYMATSRQLRRLDSVTKSPIYSHFSETVSGLSIIRAFEHQQRFLKHSEGII
DTNQKCVFSWIISNRWLAVRLELVGNLVVFFSALLIVIYRDNLKGDMVGLVLSNALNITQ
TLNWLVRMTSELETNIVSVERINEYIKVKNEAPWLLEKRPPDNWPSKGEIRFTDYKVRYR
PELDLILHGITCNIEGTEKIGVVGRTGAGKSSLTNCLFRILEAAEGQITIDGLDIASIGL
HDLRNKLTIIPQDPILFTGTLRMNLDPFNKYSDEEVWMALELAHLKPYVAGLPQGLSYEV
SEAGDNFSIGQRQLLCLARALLQKSKILIMDEATAAVDLETDHLIQVTIRKEFSDCTVIT
IAHRLHTIMDSDRVMVLDRGKIIEFDSPEKLLQRTGPFYFMAKDAGIESLNTAL
Download sequence
Identical sequences F6Z127
ENSMODP00000004154 ENSMODP00000004154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]