SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6Z2J3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z2J3
Domain Number 1 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 563-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.34e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.71e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 134-194
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 7 Region: 507-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 608-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.31e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 246-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000368
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6Z2J3
Sequence length 668
Comment (tr|F6Z2J3|F6Z2J3_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000030224} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAGFQFSNRGGKKVTNQELGREPIAPPLPSPPRPAKDLAERVPDRKRTTFPGGRRGLFLL
SAGSAPSERASGPGSACAAAVLPWTSRGLLCWGWSLSPGGWARKRKETPVGGQGSSQARG
REPEGMAPGSPRPSPQELVTFHDVAVDFTPEQWGLLDHPQKLLYKEVMLENAQNLLSLGL
PVPREYLLSCFEQEGLKNSCQDAETRFGVKKISEKLKLSSQISYSQYNEYKDDFTKHERI
YAEVENYEFSQHGKAFRKSSRVTQNKKIHPEEKPVECHECGKAFKNHSYLIIHERMHSGE
KPYECNQCGKAFIVRGHLARHQRIHSGEKPYECNQCGKTFRDSYGLTRHQHIHSGEKIYE
CTQCGKAFKDNYSLTKHQSIHSGEKPYECNQCGKTFRYNYSLTKHQSIHSGEKLYECNQC
SKTFFRKSSLTRHQHIHSGEKRYECNQCGKTFRDNFCLSTHQLIHSGEKPYGCNQCGKTF
RFSCSLTTHQRIHSRERPYKCNQCGKTFRCGSNLTIHQRIHTGEKPYKCNQCGKAFARKH
RLTCHYTIHNEKKPHECHECGKTFAVRSSLIVHQRIHTGEKYECTECGKAFTNSSSLTYH
QRTHTGEKPYECNQCGKAFRINSNLAVHKRTHTGEKPYECHQCGKAFSWRNSFVYHQRTH
CGKKPECH
Download sequence
Identical sequences F6Z2J3
ENSMODP00000030224 ENSMODP00000030224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]