SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6Z6B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Z6B8
Domain Number 1 Region: 18-97
Classification Level Classification E-value
Superfamily HR1 repeat 2.54e-18
Family HR1 repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 502-591
Classification Level Classification E-value
Superfamily PDZ domain-like 1.15e-16
Family PDZ domain 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6Z6B8
Sequence length 685
Comment (tr|F6Z6B8|F6Z6B8_MONDO) Rhophilin Rho GTPase binding protein 2 {ECO:0000313|Ensembl:ENSMODP00000015329} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=RHPN2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTDTLPPPTRKPLDEEGECYFRKGCNPLAQTGRSKLQNQRAVLNQQIMKAVRMRNGAENL
LRATTNNKVRDQVLLELSYVNSDLQILKEELEGLNISVEVYQNTEETFTIPLIPLGLKET
KEVDFSVLLKDFILEHYSEDSSLYEDEIADLMDLRQACRTPSRDEAGIELLTTYFIQLGF
VENRFFPPTRHMGILFTWYDSLTGVPVSQQNLLLEKASILFNIGAVYTQIGTRSNRQTQT
GLEHAVDAFQRAAGVLNYLKETFTHTPSYDMSPAMLNVLVKMMLAQAQEIIFEKISLPGI
RNEFFTLVKMAQEASKVGEVYLQLHSAMSQEPVKENIPYSWATLVKVKSDHYRALAHYFA
ATLLIDHQLNPGDDEDQQEKCLSQLYDHMPEGFTPLATLKNKNDRKQLGKSHLRKAIADH
EESVRAASLCKKLRNIEILQEILSVAHKRSHLKYSQHEQDDDFLNLIDAPDITSKTEQEA
EMMAPQFSKVVVTDFFQKLGPLSLFSANKRWTAPRNIHFTTEEGDLGFTLRGGSPVQIHF
LDPYCSAALAGAKEGDYIVSIQDTDCKWLTVSEVMQKLKALEEEDIEMKVVSLMDSASSM
HNKCATYSVGMQKTYSMICLAIDEDKIDKSKKISKKLSFLSWGTNKNRQKSASTLCLPSV
GVARPQIKKKLPSPFGLLNTESSLY
Download sequence
Identical sequences F6Z6B8
ENSMODP00000015329 XP_007474837.1.35504 13616.ENSMODP00000015329 ENSMODP00000015329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]