SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZDL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6ZDL1
Domain Number - Region: 15-45
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.012
Family Myosin rod fragments 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6ZDL1
Sequence length 89
Comment (tr|F6ZDL1|F6ZDL1_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000020571} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSELEEDFAKVLLLKEGRIKELEKRLAEKDEEIQELRRKLHKCQSVLPAPSSHMGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSER
Download sequence
Identical sequences F6ZDL1
13616.ENSMODP00000020571 ENSMODP00000020571 ENSMODP00000020571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]