SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6ZF42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZF42
Domain Number 1 Region: 938-1114
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.00038
Further Details:      
 
Domain Number 2 Region: 520-635
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.62e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.0013
Further Details:      
 
Domain Number 3 Region: 213-409
Classification Level Classification E-value
Superfamily PH domain-like 5.36e-27
Family Pleckstrin-homology domain (PH domain) 0.00054
Further Details:      
 
Domain Number 4 Region: 1197-1344
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-17
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 
Domain Number 5 Region: 634-805
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000384
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 6 Region: 7-63
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000471
Family SAM (sterile alpha motif) domain 0.0038
Further Details:      
 
Domain Number 7 Region: 422-530
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000478
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 8 Region: 823-935
Classification Level Classification E-value
Superfamily PH domain-like 0.00000042
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 9 Region: 1142-1217
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000439
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6ZF42
Sequence length 1573
Comment (tr|F6ZF42|F6ZF42_MONDO) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 {ECO:0000313|Ensembl:ENSMODP00000013200} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ARAP3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MESPRDLDIEVWLAGVHLERYADTFRRHGVSTAAAAQSLSQEDLRRMGIWATGHRKRILR
LLQGASLEVPTDVPQDTTMDTPTPDPQALPTKPVPKPRTVFTFFSTTQGESAPPSLLDPP
METLPVIQGEDTSLIVQDEGSMVPKGSEQSVSQEPSLSTFQSPVVPSLPLDPPPILDRMT
MMPNDIYFGLDLGRGTQPGIQETTTDGSLLNSPTPIPTSRPTAGTVHIMDPSSLYYGVQP
VSVPGIPKGRKIRAVSQASGESRPSSHEPEGGEDCGYASLELPGESTHLVSNLDPEEPGD
DLISPYASFTSLADPPAPVLSGWLDKLSPQGNYVFQRRFVRFNGKKLMYYGSDKDSFPKG
VIPLTVIEMIRSCKDCKFQVITSQRVFVFRAESEVQRDNWCSTLQSRLKEQRLLGNPRPP
HPPRPLRTGTLELRGHKAKVFAALSPGELGLYKSEQSFSLGIGICFIELRGCSVRETKNR
SFDLLTPHRSFSFTAESACTRQVWAAALQEAITETLSDYEVAEKIWSNRANRQCADCGAS
RPDWASINLGVVICKHCAGQHRALGSGVSKVQSLKLDTSIWSNEIVQLFLILGNDGANRF
WIKALPPGGGLHPDTPPGPRGDFISRKYRLGLFRGPHPQYPDHSQLLQALCTAVMGPNLL
KTMIQLFSYEEPCSEGSFSNLLPLDPSPGVYNEVLVPATLSGFLHCSPISSKSGPPPHRR
GRDAPPRLWCVLGAALEMFSSETNSEPISLIQPQDVVCLGVSPPPVDPGDLDRFPFSFEL
ILTGERVQYFGTDGADSLEAWTRAVGKWFSPLSCHQLLGPGLLRLGRLRLRSPSQTAMTP
GLWLSAFGLLRGDHLFLCPAPGPGSPAPEDTVHLRRLQEISVVSANDSSDKKDHLVLVET
GRTLYLQGEGRIDFAGWSTAIGGAAGGGGTSLQGQQMSRGDIPIIVDACISFVTQHGLRL
EGVYRKGGARARSLRLLAEFRQDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLL
PRWREAAELPQKSQRLERYKEVIGCLPRVNHRTLSTLIGHLYRVQKCAALNQMCTRNLAL
LFAPSVFQTDGRGEHEVRVLQELIDNYVSVFDIDSDQVAQIDLEVSLITTWKDVQLSQAG
DIIMEVYLEQQLPDNCVTLKVSPTLTAEELTNQVLEMRGATAGTDLWLTFEIREHGELER
PLHPKERVLEQALQWCQLPEPGSASLLLRRVSLAQASCLFTGVRRESPRVGLLRCREEHP
KLLGSRFQERFFLLRGRCLLLLKEKRSSKPEREWPLEGAKVYLGIRRKLKPPTPWGFTLI
LEKLQLYLSCTDEAEMWDWTTSILKAQHDDLQPVVLRRHSSSDLARQKFGTMPLLPIRGD
DSGATLLSANQTLRRLHNRRTLSMFFPLKLSQDSVEEQEEEAEEPVYEEVGAFPELTKDS
PLPLEWTSEPEVPRDSPSSQTVFPEQSQSLQSDGPLLSKSSSLGQEKGPPELPSGPSQKT
SFQHHLSLEDKLLQELNSLILRKGEATAFSLPASQPPSPPTWTPNPINPTTQTPGHSPKS
PCNSHSPSGQPLT
Download sequence
Identical sequences F6ZF42
ENSMODP00000013200 ENSMODP00000013200 XP_007473848.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]