SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7A8Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7A8Y1
Domain Number 1 Region: 126-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000642
Family EGF-type module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7A8Y1
Sequence length 237
Comment (tr|F7A8Y1|F7A8Y1_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000023962} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=AREG OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MKAPLQPPPPLTPSPVLLSLLVLSAVCHHVAASDTNDTYPERKDLFSGDHSTDGVELPSG
SEMSSGTEYDYSGEYEEDPQLSGYFIDDSIRVGRLVKPKKNRTESEKNSDKTRRKKNRGK
KRKPKKKVNPCDAKYQSYCIHGECKYIESLEAVTCKCHQDYFGERCVEQSMKTHSLGDGG
RFGTALAIVAGLLSVLCFSAIVVIIVQIRKVHSNVHDLEAEERRHLRQENGNGSIRV
Download sequence
Identical sequences F7A8Y1
ENSMODP00000023962 XP_007495739.1.35504 13616.ENSMODP00000023962 ENSMODP00000023962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]