SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7A9E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7A9E4
Domain Number 1 Region: 786-835
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000158
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 428-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000225
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 824-868
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000253
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  F7A9E4
Domain Number - Region: 209-244
Classification Level Classification E-value
Superfamily Expressed protein At2g23090/F21P24.15 0.0112
Family Expressed protein At2g23090/F21P24.15 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7A9E4
Sequence length 883
Comment (tr|F7A9E4|F7A9E4_MONDO) B-cell CLL/lymphoma 11B {ECO:0000313|Ensembl:ENSMODP00000011986} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=BCL11B OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSRRKQGNPQHLSQREIITQADHVEAAIVDEDEGLEIEEPGGLGLTTGGTDPDLLTCGQC
QMNFPLRDILVFIEHKKKQCSGSLGVCYEKSLDKSSPPPSSRSELRKVSEPVEIGIQVTP
DEDDRLLTPTKGICPKQENIAGPSRPAKLPAAPITASSHPHTSVITPPLRSLASLPPCFS
LPCCAGHSVSVGGTQAESQTDTSGTFGCHCQLSGKDEPSSYICTTCKQPFNSAWFLLQHA
QNTHGFRIYLETSPSNSSLTPRITIPPPLGPEAVAQSPLMNFLGDNNPFSLLRMTGPILR
DHPGFGEGRLPNTPPLFSPPPRHHLDPHRLSAEEMGLVAQHPSAFDRVMRLNPMAIDSPA
MDFSRRLRELAGNNSTPPPVSPNRSNPMHRLLNPFQPSPKSPFLSTPPLPPMPPSSTTPP
QPQAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHK
AGSMTGRSDDGLSTTSSPEPGTSELTGEGLKSSEADFRNESDPSLGHDNEEEEEEEEEEE
ELENESRPESSFSMDSELSRNRENGSKSLPDEKSLVLGKVIENVSLGAIQQYNDMLAEKQ
KRSSFMKRSSDQRDLCSRDLCQRDTGDEDSVAGELDRTEEGTVNGRSFGPGEPFPGLFPR
KPTPITSPSLNNSSKRIKIEKDLDLPPATIIPSENVYSQWLVGYAASRHFMKDPFLGFTD
SRQSPFATSSEHSSENGSLRFSTPPGDMLDGGLSGRSGTASGGSTPHISGPGPGRPSSKE
GRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQIGK
EVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQAERS
Download sequence
Identical sequences F7A9E4
XP_007473668.1.35504 ENSMODP00000011986 ENSMODP00000011986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]