SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7A9H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7A9H6
Domain Number 1 Region: 54-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000503
Family EGF-type module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7A9H6
Sequence length 152
Comment (tr|F7A9H6|F7A9H6_MONDO) Epithelial mitogen {ECO:0000313|Ensembl:ENSMODP00000023958} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=EPGN OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MALGIPWYILLNAMVSLSKEAAVPVSTPITSQPSNWTVNKTEAEYTEGPIALKFSHTCLA
DHHSYCINGICVFHHELKKATCRCTTGYTGERCEHLTLNSYAVDSYEKYIAVGIGVGLLL
SLFLAIIYCYIKKRYMKLKPPYKVCSGERRPL
Download sequence
Identical sequences F7A9H6
ENSMODP00000023958 ENSMODP00000023958 XP_007495735.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]