SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7AHX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AHX7
Domain Number 1 Region: 137-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000743
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 2 Region: 55-182
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000119
Family Growth factor receptor domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7AHX7
Sequence length 280
Comment (tr|F7AHX7|F7AHX7_MONDO) EGF like domain multiple 7 {ECO:0000313|Ensembl:ENSMODP00000021950} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=EGFL7 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MWGPGGLLVTWIFILGLGGTESFYRPGRRICSTAATRQTVPVTESYLQRVYQPYITTCEG
HKACSTYRTIYKTAYRYTSQTASPPQYDCCPGWRRSNGIPGCGTAICHSPCQNGGSCARP
GKCKCSAGWQGDTCQIDVDECNKPGHGCPQNCINIPGSYHCQCQQGYELSSDGTLCQPQR
VSPGVTSTLSPTGQPQPEASDEMKEEIQKLRSRVDMLEEKLQLMLAPFHSVAPQVSEDGP
SDHMSLLAHSFQQLDRIDSLSEQILFLEERLETCSCKNKQ
Download sequence
Identical sequences F7AHX7
ENSMODP00000021950 ENSMODP00000021950 XP_007475362.1.35504 XP_007475363.1.35504 XP_007475364.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]