SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7AK52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AK52
Domain Number 1 Region: 613-868
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-56
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 3-259
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-53
Family YWTD domain 0.00000233
Further Details:      
 
Domain Number 3 Region: 314-542
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-46
Family YWTD domain 0.00000393
Further Details:      
 
Domain Number 4 Region: 915-1178
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-37
Family YWTD domain 0.0000584
Further Details:      
 
Domain Number 5 Region: 1307-1343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1269-1305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1229-1267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 568-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 9 Region: 871-922
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 269-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000651
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1186-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000884
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7AK52
Sequence length 1587
Comment (tr|F7AK52|F7AK52_HORSE) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=LRP5 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
ASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQT
YLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDL
DQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLY
WADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTEKR
KEILSPTGVPYSLAVLGRERHGPVLHTRCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQ
DNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWT
DDEVRAIRRAYLGSGKQTLVNTEINDPDGIAVDWVARLTWTDTGTDRIEVTRLNGTSRKI
LVSEDLDEPRAIVLHPAMGLMYWTDWGENPKIECANLDGQERRVLVNTSLGWPNGLALDL
QEGRLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVH
KVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADGNGGCSHLCFFTPHATKCGCPIGLE
LLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWT
DVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFR
QVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTID
YADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERAD
KTNGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCSCASHY
TLDPSSRNCSPPTTFLLFSQKCAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIY
WVDGRQNIKRAKDDGTQASAPPFVLTSPGQSQSPDRQPHDLSIDIYSRTLFWTCEATNTI
NVHRLNGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFT
TGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPMGLTVLGKHLY
WIDRQQQMIERVEKTTGDKRTRVQGRVAHLTSIHAVEDVSLEEFSAHPCARDNGGCSHIC
IAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDD
QSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQC
VLIKQQCDSFPDCMDGSDELMCEITKPPSDDTPAHSSAIGPVIGIILSLFVMGGVYFVCQ
RVVCQRYAGATGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGISCGKSMMGSVSLMGGRG
GVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPY
RPYIIRGVAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAED
SCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences F7AK52
ENSECAP00000011585 ENSECAP00000011585 9796.ENSECAP00000011585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]