SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7AU01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AU01
Domain Number 1 Region: 14-386
Classification Level Classification E-value
Superfamily ALDH-like 4.79e-135
Family ALDH-like 0.00000000000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7AU01
Sequence length 390
Comment (tr|F7AU01|F7AU01_CALJA) Aldehyde dehydrogenase 1 family member A1 {ECO:0000313|Ensembl:ENSCJAP00000022056} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ALDH1A1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSSSDVPDLPALLTDLKIQYTKIFINNEWHNSVSGKKFPVFNPATEEELCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLMERDRLLLATMESMNGGNTVIVKPA
EQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKIAFTGSTEVGKIIK
EAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGLFYHQGQCCIAASRLFVEESI
YDEFVRRSVERAKKYVLGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPW
GNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTK
DIDKAITISSALQAGTVWVNCYGVGRVRFT
Download sequence
Identical sequences F7AU01
ENSCJAP00000022056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]