SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7AZ76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AZ76
Domain Number 1 Region: 338-452,572-718
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.72e-63
Family Phosphate binding protein-like 0.00000000208
Further Details:      
 
Domain Number 2 Region: 5-319
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.1e-49
Family L-arabinose binding protein-like 0.0061
Further Details:      
 
Domain Number 3 Region: 468-571
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000022
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7AZ76
Sequence length 837
Comment (tr|F7AZ76|F7AZ76_CALJA) Glutamate ionotropic receptor AMPA type subunit 1 {ECO:0000313|Ensembl:ENSCJAP00000051777} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GRIA1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPEL
QDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLF
QDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGAN
VTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRR
QRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVI
EMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQF
EGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVA
VAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIG
VSVVLFLVSRFSPYEWHSEELEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRS
LSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGST
KEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQR
KPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGS
GGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQS
INEAIRTSTLPRNSGAGASGGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL
Download sequence
Identical sequences F7AZ76
ENSCJAP00000051777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]