SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7B887 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7B887
Domain Number 1 Region: 36-510
Classification Level Classification E-value
Superfamily Cytochrome P450 1.83e-115
Family Cytochrome P450 0.000000000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7B887
Sequence length 510
Comment (tr|F7B887|F7B887_MONDO) Cytochrome P450 family 2 subfamily S member 1 {ECO:0000313|Ensembl:ENSMODP00000010468} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CYP2S1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MALATGVASPLLVLVLVLVLLLALLVLRQGRPRSSRLPPGPPPLPLLGNVGQLRLSPLFN
PSDCFSLQLSAKYGPVFTVYLGSRPVVVLSGYRAVKEALVDQAEAFSGRGKIAGLEKTFH
EHGLFFANGEQWRSLRKFTTLSLRALGMGKKEGEEHIQEEARCLLEALRSTQGSPLDPSL
LLSQAVSNITCLLLFGKRFDYEDKKFQAMVLATAGILTEISSPWGQVCEMFMGPVCYLSD
ILKYLSAPHGRLTRHLSTLAAFVSDQIQQHQETLDPEAPVRDFIDDFLLKMRQEEKAQGV
GPDHTDFLLTTVNLLFAGTVTVSATLRFAFLLLLKYPEFQDRIHEELNQELGRERAPSLG
DRGRLPYTDAFLHEVQRFLALIPMGVPRTVTKPTIFQGYELPQGIEVFPLLGSVLHDPEF
FERPKEFYPRHFLNADGRFIKNEAFLPFSSGKRICLGEGLARTELFLFFTTILQNFSLES
PSPLGALSLHPAISGFANIPPTFQLRFRPR
Download sequence
Identical sequences F7B887
ENSMODP00000010468 XP_007492004.1.35504 ENSMODP00000010468 13616.ENSMODP00000010468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]