SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7B9T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7B9T0
Domain Number - Region: 249-328
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0837
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7B9T0
Sequence length 915
Comment (tr|F7B9T0|F7B9T0_MONDO) Trafficking kinesin protein 2 {ECO:0000313|Ensembl:ENSMODP00000018999} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=TRAK2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTLPWNAISNSLTRERNLMNINHKDSESITDVCSNEDLPEVELVSLLEEQLPQYKLRVDS
LFLYENQDWTQSPHQNQHDSDAISPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLA
ERDRDLELAARIGQALLKRNHVLSEQNETLEEQLGQAFDQVNQLQHELSKKDELLRIVSI
ASEESETDSSCSTPLKFNESFSLSQGLLQLDMLQEKLKELEEENLALRSKACDIKTETIT
YEEKEQQLVNDCVKELRETNAQMSRMTEELSGKSDELIRYQEEISSLLSQIVDLQHKLKE
HVIEKEELRLHLQASKDAQRQLTMELHELQDRNAECLGMLHESQEEVKELRSRSSPAAHV
YGPQQCGAFSAESLAAEIEGTMRKELSLDEESSLCKQKVQQKRVFDTVKVANDARCRSAS
FPALLPIPGSNRSSVIMTAMPFQSDLQHMESSKHLNPKSSMDDTSKDSLKIELPGTPGVN
DLATALHRLWLRRHNYLSEKQFFAEEWERKMHVLAGEKEEASGYSTPTGSFASLCTNQSE
VTDLSTSTSCIRAFMPEKLQIVKPLEGSQTLHHWQQLAQPNLGTILDPRPGVITKGFTVL
PEDAIYHLSDLEEDEDGGITFQVQQPFQEEGKPSMSKPVPSIFLPPITSTSVPLTASNPG
KCLSSTNSTFTFTTCRILHPSDITQVTPSSKFPSLSCGSTSSSTPSTAMNSPALSYRLSM
GESVTSRRDSTTTCSSTMSLAKLLQERGISAKVYHSPISENPLILPAIKVPAIPSTPPNS
PSRSPCSSPLPFEPRAQISENFLASRPAETFLQEMYGLRPSKTPPDIGQLKMNLVDRLKR
LGIARVIKTPEMKENGKSQQGTEIGLRRPDSAAFLNASSNLLGGLRRNQSLPVMMGSFGA
PVCTSSPKMAILKED
Download sequence
Identical sequences F7B9T0
XP_003341889.1.35504 XP_007501674.1.35504 ENSMODP00000018999 ENSMODP00000018999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]