SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7BDH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BDH2
Domain Number 1 Region: 142-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000525
Family EGF-type module 0.006
Further Details:      
 
Domain Number 2 Region: 100-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000149
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7BDH2
Sequence length 418
Comment (tr|F7BDH2|F7BDH2_MONDO) Collagen and calcium binding EGF domains 1 {ECO:0000313|Ensembl:ENSMODP00000025548} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CCBE1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MVLPLPLPLLLLPPPPPSGRGGAKSQLGRSLGPLLLLLALGHTWTYREEFEDSDREVCSE
NKIATTKYPCLKPTGELTTCYTKKCCKGYKFVLGQCIPEDYDVCSEAPCEQQCTDNFGRV
LCTCYPGYRYDRERHRNKVKPYCLDIDECATSNETLCSQICINTLGSYRCECREGYIREE
DGRTCTKGDKGEHHIGHDEKVENVLKAGTCCATCKEFHQMKQMVLQLKQKIALLPNNAAD
LGKHVTVDKLLASNTYLPGPPGQPGGQGPPGSPGPKGSPGFPGVPGPPGQPGPRGSMGPI
GPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPKGSPGPPGSFDFLLLMMADIRND
IAELQEKVFGHRTHSSAEEFPLPQEFTNYPDVLDFGSGEDYPKRTETRDSRIHKDLYP
Download sequence
Identical sequences F7BDH2
ENSMODP00000025548 ENSMODP00000025548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]