SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7BHH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BHH6
Domain Number 1 Region: 145-465
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.26e-81
Family IF2B-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7BHH6
Sequence length 471
Comment (tr|F7BHH6|F7BHH6_CIOIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSCINP00000007226} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=LOC100187323 OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MNNGDAENLTSEQKKQLKKERRKEKNAQKEKHNIPSKPEGEEPKIEKSKAELRAERRAKQ
EADRAAKASKKSDQVAANTKQKGPRVPANIQADDPKVQKKAAKKLEKQQVPQRTEGQKKV
ALFSHLHQYERSLSITKNIGFGKNAIHPAIIRLGLQYAEGTVTGSNARCAALMSAICKLI
SDYETPPQKELSRHLESKLKPAISFLDQCRPLSVSMGSAIKYIKLQITNIPTGMSDSEAK
LRLIKSLREFVHVNIVLAGEAISGYACTKITDGDVVMVFGSSSLITKVLCDAHNAGIKFS
VIVVDGRPKLSGRGTLRKLCRVGIKCSYVLVSAASYIMPEVTKVFLGAHGLLSNGYVMGS
VGTSMVAMAAKIRGVPVIVCCEAYKFCERVQTDSFVNNEIGDPRDLLVQNKSELTSPLLT
NAAWEETDSLKVLHLTYDVTPPDFVAMVVTELGKIPCTSVPVVLRVRSLET
Download sequence
Identical sequences F7BHH6
ENSCINP00000007226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]