SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7BHS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BHS6
Domain Number 1 Region: 35-540
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 2.49e-138
Family Prokaryotic type I DNA topoisomerase 0.000045
Further Details:      
 
Domain Number 2 Region: 641-683
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000306
Family PhnA zinc-binding domain 0.052
Further Details:      
 
Weak hits

Sequence:  F7BHS6
Domain Number - Region: 966-994
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0105
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7BHS6
Sequence length 996
Comment (tr|F7BHS6|F7BHS6_CALJA) DNA topoisomerase {ECO:0000256|RuleBase:RU362092} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TOP3A OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MIFPVARYALRCLRRPGGRAFSRAAMEVALRGVRKVLCVAEKNDAAKGIADLLSNGRMRR
REGLSKFNKIYEFDYHLYGQNVTMVMTSVSGHLLAHDFQMQFRKWSSCNPLVLFEAEIEK
YCPENFVDIKKTLERETHQCQALVIWTDCDREGENIGFEIIHVCKAVKPSLQVLRARFSE
ITPHAVRTACENLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQKIFPEVLSEQLIS
YGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHKDGIVEFSWKRHRLFNHTACLVLY
QLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYI
SYPRTETNIFPRDLNLTVLVEQQTPDPRWGAFAQSILERGGPTPRNGNKSDQAHPPIHPT
KYTNSLQGNEQRLYEFIVRHFLACCSQDAQGQETTVEIDISQERFVAHGLMILARNYLDV
YPYDHWSDKILPVYEQGFRFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGQSSGYLI
SLEHLLCTRHRFPLVFKQFCNAGTISLSPFYSSEVKNLPKVSRARWLTPVIPALWEAEAE
CCRCLCSNCRLMGVYLCLLFRLDEALAQYFGNGTEVAQQEDIYPAMPEPIRKCPQCNKDM
VLKTKKNGGLYLSCTGFPECRSAIWFPDSVLEASRDGSVCPVCQPHPVYRLKLKFKRGSL
PPTMPLEFVCCIGGCDETLREILDLRFSQGPPRASQPSGRLQASQYLNRMDSSHHPQPAD
GRQTGPSKALAWTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNQGRQFFKCNTGSCNF
FLWADSPNLGAGGLPTSAYRPLGGSLGCPPGPGTHLGGFGNPGVGSGNGTSCLCSQPTVK
RTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENMAPGTSGALPWKRGGGGTLGLEARSK
RPRASSSDMGSTAKKPRKCSLCHQPGHTRPFCPQNR
Download sequence
Identical sequences F7BHS6
ENSCJAP00000049448 ENSCJAP00000049448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]