SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7BJY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BJY8
Domain Number 1 Region: 143-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000976
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 
Domain Number 2 Region: 73-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000115
Family HkH motif-containing C2H2 finger 0.005
Further Details:      
 
Domain Number 3 Region: 4-51
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000238
Family HkH motif-containing C2H2 finger 0.0045
Further Details:      
 
Domain Number 4 Region: 205-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000223
Family HkH motif-containing C2H2 finger 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7BJY8
Sequence length 238
Comment (tr|F7BJY8|F7BJY8_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000011935} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
LLDEHKRNDLFTDNFCKVCGAVLQFESQRISHYEGKKHAQKVRLYFQIHGEQNEAQVPDK
KVKLDFLSLQVIVDKNKFCDLCNMIFSSPVVAQSHYLGKVHAKKLKQLMGEHAQTSPPRP
EPQQPASERAAPEAATEEAPPSSGGPTLDLNDPDRYCELCCASFNSPLMAQQHYVGKKHK
RSEARKKILEEIGQKTLPAESTSSALGVGHYICPICSITLTSIEMYQSHMQGNKHQIK
Download sequence
Identical sequences F7BJY8
ENSMODP00000011935 13616.ENSMODP00000011935 ENSMODP00000011935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]