SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7BKP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BKP6
Domain Number 1 Region: 48-507
Classification Level Classification E-value
Superfamily Cytochrome P450 5.37e-123
Family Cytochrome P450 0.00000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7BKP6
Sequence length 516
Comment (tr|F7BKP6|F7BKP6_MONDO) Cytochrome P450 {ECO:0000256|RuleBase:RU000461} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CYP1A1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MMTSILSLLGFSKSFTVTELLVVSAVFCLVFWIIDSYHQRVPKGFKSPPGPWAWPLIGNV
LTLGKNPHLVLTQMREKYGDVMQIQIGSTPVLVLSGLETIRHALVKQGDDFKGRPDLYSF
SLILDGESLSFGPDSGEVWAARRKLTQNALKAFSISSSPSSSFCYLEEHVIKEAEYLIQK
FQEQKGHFDPVRYIVVSVANVICAICFGQRYDHDDQELLNIVRLSNKFGEVAASGNPVDF
IPILRYLPNSKITAFRDLNEKIVAFTQKLVKEHYRKFEKGCIRDITDSLIEHCQEKKLDE
NANIMLSEKKVVNVVIDLFGAGFDTVTTAISWGLMYLVAKPEVQKKIHEELDTVIGRERL
PQLSDKTQLPYMEAFILETFRHSSFLPFTIPHSTTRDITLNGFYIPKGRCVFVNQWQINH
DPKIWGDPSVFRPERFLSVDGTINKALSEKVIMFGLGKRKCIGETIARWEVFLFLSILLH
RMEFSVPSGVKVDLTPVYGLTMKHIPCEHFQTKLRS
Download sequence
Identical sequences F7BKP6
ENSMODP00000011788 ENSMODP00000011788 XP_001379519.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]