SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7C1X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7C1X6
Domain Number 1 Region: 31-462
Classification Level Classification E-value
Superfamily Cytochrome P450 9.43e-62
Family Cytochrome P450 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7C1X6
Sequence length 463
Comment (tr|F7C1X6|F7C1X6_MONDO) Cytochrome P450 family 20 subfamily A member 1 {ECO:0000313|Ensembl:ENSMODP00000020324} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CYP20A1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MLDFAIFAVTFLLVLVGAVLYLYPASRQASGIPGITPTEEKDGNLPDIVNSGSLHEFLVN
LHERYGPVVSFWFGRRLVVSLGTMDALRQHINPNRTSHPFETMLKSLLRYQSGLDGDAVE
NHIRKKLYENGVNKSLQSNFAFMVKLSEELLGKWLSYPESQHVPLCQHMLGYAMKAVTQI
AMGNSFEDDQKVIHFQKNHNTVWSEIGKGFLDGSLDKSTTRKKQYEEALMEIETVFKKVI
KERRGRNFSQHIFIDSLLQGNLNEKQILEDSMIFSLAGCVITANLCMWAVYFLTTSEDVQ
KKLHKELDQVLGKGPITQEKIDQLRYCRQVLCETVRTAKLTPIAAKLQDLEGKVDQHIIP
RETLVLYALGVVLQDHCAWPSPYKFDPDRFNDESAMKNLSLLGFSGTQECPELRFAYMVA
TVLLSVLVRKLYLHPLEGQVIETKYELVTSSKEEAWITVSKRN
Download sequence
Identical sequences F7C1X6
XP_001366710.1.35504 ENSMODP00000020324 13616.ENSMODP00000020324 ENSMODP00000020324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]