SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7C435 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7C435
Domain Number 1 Region: 81-275
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.63e-58
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 395-497
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-37
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 3 Region: 544-654
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 4 Region: 834-927
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-30
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 5 Region: 699-809
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-29
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 6 Region: 278-359
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-22
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 7 Region: 499-542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000227
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 652-696
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000484
Family EGF-type module 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7C435
Sequence length 938
Comment (tr|F7C435|F7C435_MONDO) Metalloendopeptidase {ECO:0000256|RuleBase:RU361183} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=BMP1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
AAFLGDIALDEEDLKAFQVEQIAELRQQAILRATGKASGITRNSSTPANQHARGRLQRKA
REKLGGRGRGRSRNRRAATSRPERVWVDGIIPFVIGGNFTGDQRAVFRQAMRHWEKHTCV
TFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHE
HTRPDRDNHVAIVRENIQPGQEYNFLKMELEEVESLGETYDFDSIMHYARNTFSRGIFLD
TIVPKYDVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSA
HMHCVWRISVTPGEKILLNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGNHVLPCPRHH
ERERLQVDSCLSIFWKGKKFGMIVSSICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQV
SEGFHVGLTFQSFEIERHDSCAYDYLEVRDGNSETSTLIGRYCGYEKPDDIKSTSSRLWL
KFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRC
EAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYD
FVEVRSGLTADSKLHGKFCGAEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDEC
SKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKY
PSKKECTWSIYSTAGHRVKHGKMPNLDIESQPECTYDHEVYDGRDAKPVLGRFCGSKKPE
PILATGNRMFLRFFSDNSVQRKGFQASHSTECGGHVRAEVKTKDLYSHAQFGDNNYPGGS
DCEWVIVAEEGYGVELVFQTFEVEEEADCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVY
SAGDSVLVRFHSDDTINKKGFHLRYTSTKFQDTLHSRK
Download sequence
Identical sequences F7C435
13616.ENSMODP00000011921 ENSMODP00000011921 ENSMODP00000011921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]