SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7C8M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7C8M1
Domain Number 1 Region: 690-836
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.89e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 232-365
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-22
Family Phosphotyrosine-binding domain (PTB) 0.021
Further Details:      
 
Domain Number 3 Region: 6-99
Classification Level Classification E-value
Superfamily PDZ domain-like 6.52e-20
Family PDZ domain 0.0091
Further Details:      
 
Domain Number 4 Region: 961-1030
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000225
Family Ras-binding domain, RBD 0.061
Further Details:      
 
Domain Number 5 Region: 1016-1112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000558
Family Ras-binding domain, RBD 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7C8M1
Sequence length 1504
Comment (tr|F7C8M1|F7C8M1_MONDO) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSMODP00000004282} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=RGS12 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MYKPVETAKRRLNVHAPPRIRSVDVARGRAGYGFTLSGQAPCILSCVMKGSPADYVGLKA
GDQIFAVNDINVKKASHEDVVKLIGKCSGVLHMIIGEGVSHMDSCSSDEEVGFYEGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFSMIFENPTLCAASSDHTKPKQRSLSESAAAAAA
AGFDIAQESINSPNYNLHSKEEISKVIHDDSVFSIGLENHDDFGLDASILNVAMVVGYLG
SIELPSTSSNLEYDSLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCTDKAGVVAEYPA
EKLAFSAVCPDDRRFFGLVTMQSNDDGSLAQEDEGVLRTSCHVFMVDPELFSHKIHQGIA
RRFGFDCTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADVHQNN
STSSNSDSGIGNFNQEEKSNRVLVVDLGASSSKHIPSNMWENPGARASNPTTAHWNGFCH
DLEGNSLEATQNDKFCDLNKHLGPSSRMEVPLVSSRSSVPPSKRSAMGMGGTSNQRWLPV
HVLQEWQHGHASDQESYTDSTDGWSSVNCGTLPPPMYNIPADRYRVEGAYVHPQLIVPTS
EWLKKAFGMQTIYALHRNVRKTKKCLGLKFGHGIGLAHTPQRTSTRRSFGRSKRFSITRS
LDDLESATVSDGELNSTDLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSLERLLQ
DPIGVRYFSDFLRKEFSEENILFWQACEYFSHVPAHDKKELSYRAREIFAKFLCSKATTP
VNIDSQAQLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECILAEVEGRSL
PDSQQVPSSPASKHSISSDRSSVSTPKKLSGKSKSGRSLNEESGEEDGEKKRKGTFFSWS
RNKSTGRSQKKKEHGDHLHDTLHSNGGLHRRESQGSMSSAASLDLSDTCRVSVAEKDKVS
KHCCINLPDGTSCVVVVKAGFSIKEILSGLCEKHGINVAAVDLFLVGGDKPLVLHQDSSI
LDSRDLRLEKRTLFRENTADFSLALFHRALKVTRLFRPVVSNSNRHGEKIVVLSGEKEPL
DLGVPISNLDGQRVILEEKDPTKGKVFTDKQKGASAKQNIAVIPSSRNHSATGEERTLGK
SNSIKIKGENGKNARDPRLSKREDSIAKIGKKKYQKINLDEAEEFFELISKAQYCSTNDQ
RGLLRKEDLVLPDFLRLPPCTAEPTASTPATTKGLNKRTVKNGSKEKATQPNGKLESAQN
GSESPVKSPGPAEGKPRPTLAALQSPKTPSPPFSAPLSPIPLVQEGTASAQIWKRQSKEL
HAEGIQTIEDENVADLTLVGEGDISSPNSTLLPPPPTPPSDVTKLTEANYSPPTPLTDKQ
EKPGFQRSISGANHGRTKESESFCEQIPPRPRHNSSSYLGMNSGDELPVNRIIDVDGVKG
GTSSLMPSSEPDGNLSFEGSISELRMCQGRTRMGVYRTSDLPNLLTVKSEKHKSSENQYK
ATFV
Download sequence
Identical sequences F7C8M1
ENSMODP00000004282 ENSMODP00000004282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]