SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7CDT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CDT3
Domain Number 1 Region: 28-489
Classification Level Classification E-value
Superfamily Cytochrome P450 1.23e-127
Family Cytochrome P450 0.0000000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7CDT3
Sequence length 489
Comment (tr|F7CDT3|F7CDT3_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000010413} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC100018927 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MNAGDLLLLLAVFLGFLLLLAKRPQKVNLPPGPTPLPLLGNLLQLGRHGLIKSFLECRDK
YGDVFTVYLGTRRYFVICGPESVKKALVDNAEVFSGRGTLAISEMVFQRYGFFVTYDGWK
TLRRVSIATLRDFGMGKRSIEEQIKAEAQCLVEELQKSQGALIDPTFIFHSVTANVICSI
VFGERFSYQDTQFREILNMFVEVFTILSSLWMQFFEQFPSVLKLLPGPHYRVLKIAQHIK
DFISSKIEQHQESLDPNSPRDFIDSFLLRIEKEKETPDSKYHVKNLVLTVLSLFFAGTET
TSTTLRYGFLLLLKYPQVAEKVQEEIDQVVGRDRAPEIKDRAKMPYTDAVIHEIQRFSDL
LPMGIPHMVTEDTSFQGYFLPKGTDVFILLSASLKDPCYFEKPHIFDPNHFLDAQGALKK
NEAFIPFSMGKRACLGEGIARTELFLFFTTILQNFSLVSSKPLEDLDIRPQCSGLGTLPQ
IYKLGFLPR
Download sequence
Identical sequences F7CDT3
ENSMODP00000010413 XP_001371957.1.35504 13616.ENSMODP00000010413 ENSMODP00000010413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]