SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7CGP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CGP7
Domain Number 1 Region: 2-301
Classification Level Classification E-value
Superfamily Cytochrome P450 1.26e-80
Family Cytochrome P450 0.00000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CGP7
Sequence length 311
Comment (tr|F7CGP7|F7CGP7_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000006747} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTLRNFGMGKKSIEENVQEEAKLLVEAIKQTKGLPCDPTFILGCAPCNVICSLIFQKHFE
YKDPKFLYLMKLLDDDLKLLSSPWIQVYNYFSPLIHYLPGLHHKLFKITDLQKKFILEEV
KEHQQTLDPNNIRDFIDCFLMKMEQEKQKPLSEFTIGNLVNTAIDLFAAGTETTSTTLKY
GFLMLLKHPEITEKIHEEIDRVIGYNRSPCMEDRNKVPYTNAVVHEIQRYIDHIPTSLPH
AVTEDVQFRQYLIPKGTTIIPLLTSVLYDDEEFPNPHQFDPGHFLDASGNFKKSDYFMPF
STAFKPWKPSR
Download sequence
Identical sequences F7CGP7
ENSMODP00000006747 ENSMODP00000006747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]