SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CLT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CLT7
Domain Number 1 Region: 334-411
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.12e-21
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 101-136
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000146
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 
Weak hits

Sequence:  F7CLT7
Domain Number - Region: 160-248
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000863
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 216-332
Classification Level Classification E-value
Superfamily Prefoldin 0.0162
Family Prefoldin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7CLT7
Sequence length 491
Comment (tr|F7CLT7|F7CLT7_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000016949} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC100015374 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSQRYGSSRHYSSSRSGGGAGGGSSIRISSTRGSGYGAGSIGGGFSSAGGFGSRSVGGFV
GGFSSSSYGGGSFGGSYGGVSCGGGSFGGLFDGSDGGLLSGNEKVTMQNLNDRLASYLDK
VKALEDSNSQLEQKIKEWYEKYGNSRQREPRDYSHYYDVIKDLKDQILTLTTDNANVLLQ
IDNARLAADDFRLKYENEVALHQSVEADINGLRRVLDDLTLAKTDLEVQLESLNEELAFL
KKNHEEEMKDLQNVSTGDVNVEMNAAPGVDLTENLNLLRSQYEQLAEQNRREAEAWFNEK
SKELTTEINSNVEQVSSQKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCSQ
LSEIQAQITALEEQLQQVRAETEYQNSEYQLLLDIKIRLENEIQTYRSLLEEGGSANSAA
IGHGGSSGGTYRGISGGVQGASSSSGAYGGSSAGSGGVTSSGSRRGSSVVQGGSSGSGGE
STSKSSSGTRF
Download sequence
Identical sequences F7CLT7
XP_007482312.1.35504 ENSMODP00000016949 ENSMODP00000016949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]