SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7CQT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CQT2
Domain Number 1 Region: 25-492
Classification Level Classification E-value
Superfamily Cytochrome P450 6.59e-64
Family Cytochrome P450 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CQT2
Sequence length 493
Comment (tr|F7CQT2|F7CQT2_MONDO) Cytochrome P450 family 39 subfamily A member 1 {ECO:0000313|Ensembl:ENSMODP00000023572} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CYP39A1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEIFLTALFIILGFTAFYLFHQRRDPQNPPCISGWIPWIGAGFKFGEAPLEFIEQARIKY
GPVFTVFALGNRITFVTEEEGIDVFFKSKDINFEHSVQELIEKIVSVPKDIFFSFHGILY
GLMKNKMRISHLYQFTEKMVEELHEQLETLGTDGKNDLFNLVRNSLYPVTVNFVFGKGLY
PITHKKIVEFHEHFQNFDEGLQFASQMPECFIRNWSKSKKWFLTLFEKSIPDLEKYKPSD
DDSLTIMQLITNALRQGTSEHKAPNYALLMLWASLSNLATRGVLSSIKTGYFSPIKEKEK
SNSLVACWTIMFILHNPSVYKNVMEGIVSVFGEAGKNNIKISEKDLKKLPLIKWCVLETI
RLVSPGIITRKVMEPMKILSYTIPAGDILMLSPFWIHRNPKYFPEPELFKPERWEKADLE
KNASLDCFVAFGGGKYPCPGRWFVLLEIEIFVALLFYKYQLHLVDPFPKQSLKQLMGVQR
PVTSCRVEYKCRK
Download sequence
Identical sequences F7CQT2
ENSMODP00000023572 ENSMODP00000023572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]