SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7CRB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CRB3
Domain Number 1 Region: 3165-3341
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.36e-35
Family Laminin G-like module 0.00091
Further Details:      
 
Domain Number 2 Region: 2995-3159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.7e-26
Family Laminin G-like module 0.0051
Further Details:      
 
Domain Number 3 Region: 2595-2748
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-20
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 4 Region: 2764-2910
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000109
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 5 Region: 2392-2588
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000396
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 6 Region: 1359-1410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000173
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 533-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 8 Region: 446-463,517-565,595-683
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000973
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 9 Region: 1743-1793
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 10 Region: 1691-1733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 11 Region: 1269-1317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 12 Region: 352-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 13 Region: 295-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 14 Region: 488-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 15 Region: 1408-1456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000131
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 16 Region: 681-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  F7CRB3
Domain Number - Region: 1833-1959
Classification Level Classification E-value
Superfamily Tropomyosin 0.000105
Family Tropomyosin 0.0062
Further Details:      
 
Domain Number - Region: 1654-1693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000977
Family Laminin-type module 0.046
Further Details:      
 
Domain Number - Region: 1321-1356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 2272-2382
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00497
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CRB3
Sequence length 3342
Comment (tr|F7CRB3|F7CRB3_MONDO) Laminin subunit alpha 3 {ECO:0000313|Ensembl:ENSMODP00000035538} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LAMA3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MARVRKGTPAAAPLPRWLRRLFFLLLYLLSEAAASPELETGFSLHPPYFNLAEAARISAT
ATCGEEPGGARPRSELYCKLVGGPIASSTGHTIQGQFCDYCNSGDPNKAHPVTNAIDGTE
RWWQSPPLSLGLQYNKVNVTLDLGQLFHVAYVLIKFANSPRPDLWVLERSVDSGRTYLPW
QFFAHSKIDCWEHFGTEANMPIIEDDDVICTTEYSRIVPLENGEVVVSLVNGRPGAKNFT
FSPTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGRCVCNGH
AEVCRAQGPENLFQCECQHNTCGESCGHCCAGYNQKQWQPATAEQTNECEACNCHGHATD
CYYDPDIERLKGSLNIHGVYEGGGVCINCQHNTAGVNCERCLQGYYRPYNVPVEAPHGCM
PCSCNPEYTDGCEQGTGRCICKPNFRGENCEHCAKGYYNFPFCLSIPIYPVFTPRPEAST
TPSGITGCECNSVGVTSEICDFHGKCLCRFGVGGPKCDSCSSGFYSFPACQACQCSPLGS
YQTTCDPGTGQCECRPGITGRLCDQCLSGAYDFPHCQGSSSECNPLGTMDSSSGFCQCQL
YVEGPTCSICKPLYWNLAGENPDGCSECQCDVTGTLSGVGECEQREGECYCKPHVCGDSC
NACEDGYYALEDSNYFGCQGCHCDVGGSISSVCDDLSGACQCREHIMGKSCQQPEINYYF
PDLHHMKFEIEDGTTPNGRGVRFGFDPMEFPDFSWRGYAQMTSVQNEVRVTLNVEKTRQY
LFRAILRYINPGIETVFGHITIYRMNNIFPLTGAVQSKEIVFLPSKEPSFVTIPGNGFAD
PFSLTPGMWIVNIKAEGILLDYLVLLPSDYYEASILQLPVTEPCAYWGPIGENCLLYQHL
PVTRFACVSACEAERFLLNGMPRTLGTRRPTPEHPVMAEISGREIELHLTLSIPQVDHYV
IVIEYANEDSQLYVADILINSPSSSSAGRMNIYSCKYSFLCRSFVVDDLNRVAVYELLAD
ARIQLKAHLAHFLLHQICIIPVGEFSTEYVKPSVHCIASYGQFVNQSSSCILLAHETPPT
ALVLDALNGGMLPFVPQDPLPSASGFRGVILKSPQNQVTLRGRVPHPGQYVFIVHFCQPD
YPTFPAQVVVEGGQQWSGSFSASFCPQVFGCRNLVIAESQTNLDMREPEFSVTVKVPDGK
SLMLVQVLVVPAESYGYHMLQKKSVDKSFDFINNCGGNSFYIDPLTSSGFCKDSAHSLVA
FYNNGALPCDCHVMGAINPTCHPEGGQCQCRTNVIGRQCTRCQTGYYGFPFCKLCHCGRR
LCDEMTGKCICPPRTVKPQCEVCEKQSFSYHPLVGCKVCNCSRIGAINATAPECDKNNGQ
CRCKPRITGRQCDRCTSGFYRFPECIPCNCNRDGTEPGVCDPWTGTCLCKENVEGAECNI
CQKGSFYLDPSNPKGCTSCFCFGISDLCHSTNKRRAKFVDMIGWHLETADQMVIPVTFNP
GSNSVVADIQELPSSVHSVYWIAPSSYLGDKVSSYGGFLTYQVKSFGLPSEGMMLLEKRP
DVQLSGQQMTIVYMDPNNPLPDRRYYGRVQLVEGNFRHVSSNNQVSREELMMVLSRLDGL
HIRGLYFTETQRLTLGEVGLEEVTNTGSGSIAYNVEICSCPPDYAGDSCQGCSPGYYRDN
KGFYTGRCVPCNCNGHSNRCQDGSGTCINCQHNTAGTNCERCKEGYYGDALHGSCRVCPC
PHTNSFATGCVVNGVNVKCSCKPGYVGAQCERCAPGYFGNPQKFGGSCQPCNCNNNGQLT
SCDPLTGDCIIQEPKDGGPEECDDCDSCVTTLLKDLGAMNDELRLIKSQLQSTSANAATL
EQMKHLETQTKDLRNHLLSYQSAISSRVSKIDALEKDLNSLNQDFETLQEKVQINSRKAQ
TLYNSVSQTSQSAKQLDTRIQSVIRDVHVLLKQISGTDGEGHTLPSGDLSRKLAEAERMM
KEMRSRDFREQLRKAEAEKREAQLLLNRIQSSLKNHQAENHELVKTIRDSLNEYEVKISD
LRKALQEATLQTKLANGLNQANDRALEDIKRRINEMSSLQSEFTKHLTTAESSLRQTNSV
LQLMKKSQEEYETLASSLNEVRQELSDKVKDLSRSSSKESLVVEAEKHAQSLQNLAKQLE
EIKRNTSGDELVRCAVDAAMAYENIINAVKAAEDAANKAVGASDSALQTVVKGDLPRKAK
TLSSNSDKLLREAKTTQTRLQQDINPALDSLRDTLDVVTAKKGLIQTDLATLQDDLRGIN
RDDIDRMTNNAKSLIRNANDVTSSVLDGLTPIQTHVERLQETYGSARSEDFNEALSDANN
SVKKLTSKIPDLLSKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAVPMRFNGKS
GVEVRLPNDLEDLKGYTSLSLFLQRPESREDGGEDEDMFVMYLGNKDTSKDYIGMAVRDG
KLVCVYNLGDREAETQMDPILTKSLTQEAIMDRVKFQRIFQFAKLSFFKEATSNKPKPPD
FYDMDSGSGDVLLNLDPENVVFYVGGYPPNFKLPRVLKYPPYKGCIELDDLNENVLSLYN
FKKTFNLNTTEVEPCRRNKEESDKNYFEGTGYARVPTQPSTPFPNFQQTIQTTVDEGLLF
FAEHEDFFISLIMEKGYPVLRYKLNSEPPQEKRNRVPMNDGTDQMITIRMGKVQKVLRIT
VNQSVIEVQGAQIFNFNTYYLGGIPISLREKFNITTPAFRGCMKNLKKTIGVIRLNDTVG
VTKKCSEDWKLVRTASLSRDGQLSFIDVGLPDPNYFQSSFGFQTFQPNGLLLRHQIGTNN
LQIALEDGHIELSSREQGTILKSPQTYMDGLLHYVSIIKDDAGLRLLIDDKSLKDNQRLR
IFPDSQQSLRFGGSDFEGCITNVFFQRLTQNPEVLNLVTHTRREKEKVSLGVCNLNKPPF
LMLLKSSAKLSTSRTFNIDRLQQDMRPASLMKKKVQTVAQHCLEWSQSQASKGAYQFGDS
PTSHLSYTLPEEILKDRSDFAVDIQTTSTAPGLVFFVGSKSSFMVLYFSKGRIIFLLKAE
GKKLRMKTKEKLNDGKWHTVMFGHKGSKVHFIIDGLKIQEGSLAGNSFFTVTPPIYLGAS
PQVKLKSLPKSSFIGCLRNFQLDGKALDTPSQNFGVTPCLGGPLEKGMYFSQDGGHISFD
NSWMVGKEFKIIFSIRPRSLTGLLMHTGSQPGKHLSVYMEEGKVTASVGSGAGEMLTSVT
PQQSLCDGQWHSVAVTLKQNLLQLDLDTDSSSETGQLPSLPGSNQQPLYLGGIPANLTTL
RLPVQNPFFGCLKKVTINNIAVPVTKASGVQGAVSPNGCPVH
Download sequence
Identical sequences F7CRB3
ENSMODP00000035538 ENSMODP00000035538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]