SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7CYI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CYI5
Domain Number 1 Region: 28-345
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.74e-111
Family Bee venom hyaluronidase 0.0000105
Further Details:      
 
Weak hits

Sequence:  F7CYI5
Domain Number - Region: 391-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00128
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7CYI5
Sequence length 418
Comment (tr|F7CYI5|F7CYI5_MONDO) Hyaluronoglucosaminidase {ECO:0000256|RuleBase:RU610713} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=HYAL3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MNGGCYLVAWATLCLVGGWATSWHLGRPFTAVWNVPTARCQTHFGQPLPLDPFDIVHNWA
QRFRGQNITIFYKNQFGLYPYLGPRGIVHHGGIPQAVSLHRHLALVANQISGLMHKGFRG
LAVLDWEEWHPLWNRNWGLRQVYRKAAWAWAQQQWPDLPPKQQHLKARTTFEQAARALME
STLQLGQALRPRGLWGFYRFPLCRSPWQGRHNYTGKCRKTDKVYNDQLYWLWKASSALFP
SIYLPPDLPQVYRKSYTRHRLEEAFRVAQFGHPRPLPVLAYARLTHPGSGQFLSQNDLIQ
TIGVSVALGVEGVVLWGDLSFSSSEEQCKHLQSYLSTILGPYLSNVTQAAQACSQQLCHG
NGRCARWEPSNDEVFLHLEPRRAQGTLMEGTAKWAHFRCLCYPGWEGTTCKVPVAGTE
Download sequence
Identical sequences F7CYI5
XP_007499960.1.35504 XP_007499961.1.35504 ENSMODP00000015236 ENSMODP00000015236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]