SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7D563 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7D563
Domain Number 1 Region: 41-503
Classification Level Classification E-value
Superfamily Cytochrome P450 1.13e-119
Family Cytochrome P450 0.0000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7D563
Sequence length 507
Comment (tr|F7D563|F7D563_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000037161} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC100031971 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MQLPLGNVLPSLQTLLLFSAILLILASYVQRRRRRQQSKYPPGPLRLPIFGNVFEIDIKK
PHISIQECVRKYGNIFSMDLLSAPMIVVTGLPLIKEVLVNQGQVFVDRPRSPLQSYIFKI
NGLFMSNGQEWKDQRRFTLMTLRNFGLGKKTLELRIQEEAIYLTEAIREEKGKPFNPHFQ
INNAVSNIICSVTFGNRFEYHDSQFRELLKSLNQQNLLESQCGFRPDHSTIDMVFTVRKM
QEKCLEQNLSLYIVFIDLTKAFDTVNRDSLWMILSKLRCPAKFIKLIQLFHGNISSSFNE
NNLVACTLDLFFAGTETTSTTLRWALLYMAFYPEIQGKIQAEIDRVIGHSRWPTMADREN
MPYTYAAIHEVQRMGNIVPLNAPRVATVDTTLAGYHVPKGTMLLTNLTALHRDPKEWATP
DTFNPEHFLEDGQFKKKEAFLPFSAGKRVCLGEQLARAELFIFFTCLLQRFTFQAPPDTQ
LSLDFQAGMTLSPVFYQICALPRETEP
Download sequence
Identical sequences F7D563
13616.ENSMODP00000037161 ENSMODP00000003927 ENSMODP00000037161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]