SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7DE70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DE70
Domain Number 1 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 126-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 340-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-20
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-17
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 7 Region: 97-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000314
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7DE70
Sequence length 394
Comment (tr|F7DE70|F7DE70_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000030191} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
ITFHDVAVGFTQEEWDLLDDSQKELYLEVLLDNVQNLLSVGLPVPREIFISCLWQGKAPW
MLEQKGPRNSCPGDLDLIRHPKIKHVKMVSMSDKGGRLSSHNSELAAHERIHTGEKPYEC
KQCGKTFTWSDSFVKHQRIHTGEKPYECKQCGKAYTQRGHLAAHKRIHTGERPYVCKQCG
KAFPLRGYLAKHQRIHTGERPYECKYCGKAFTQRGHLTLHQIIHTGDKSYECKLCGKAFT
RWSSVARHQRIHTGEKPYECKQCGKAFTERSNLAKHQQIHTGEKPYECKHCGKAFTRQGY
LTLHQRIHTEDKSYECKHCGKSFTRRSSVARHQRIHTGEKPYKCNQCGKAFTQRNHLAAH
QRIHTGEKPYECKHCGKAFTQRGHLAAHKRIHTG
Download sequence
Identical sequences F7DE70
13616.ENSMODP00000030191 ENSMODP00000030191 ENSMODP00000030191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]