SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7DHC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DHC2
Domain Number 1 Region: 527-558,633-707
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000161
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7DHC2
Sequence length 739
Comment (tr|F7DHC2|F7DHC2_HORSE) Solute carrier family 26 member 5 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SLC26A5 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MDHAEENEILAATQRYSVDRPIFSHPVLQERLHKKDKVPDSIGDKLKQAFICTPKKIRNI
IYMFLPITKWLPYKFKEYVLGDVSGISTRVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIM
YCFLGTSRHISIGPFAVISLMIGAVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMSV
TLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFS
VVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMGTG
ISAGFNLQESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLA
NKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMIL
LVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFL
GLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAFEEVKEIPGIKIFQINA
PIYYANSDLYSSALKRKTGVNPAHIMGARRKAMRKYAKEVGNANMANATVVKVDAAVDGE
DGTKPEEEEDEIKFPPVVTKSTFPEELQRFMPPGDNIHTIILDFTQVNFIDSVGVKTLAG
IVKEYGDVGIYVYLAGCSAQVVNDLTQNRFFENPALKKLLFHSIHDAVLGSQVREALAEQ
EASAPPPQEDSEPNATPEA
Download sequence
Identical sequences F7DHC2
ENSECAP00000005750 9796.ENSECAP00000005750 ENSECAP00000005750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]